Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U214445

Score 
352
Direction 
Forward
Predicted Peptide Sequence 
CKKFMQDPMEIYVDDEAKLTLHGLVPXITIKLSETEKNRKLNDLLDALDLQSSGIFVKSVNRAAELNKLLAECNFPSICIHSGMTXGGKI
DRYKAFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSEVLNQVQERFEVDIKELPEQ
IDTSTYMPSYDMRXVLADISIILPEDKGKLKMFALVYRLSWPFGPSILKEWWPPTLAFDSAGLLYLXLNHAVSYQLEEHDKCLLSVILFS
SKFILLNDLKTNIKDIXLETRERIDMHKMAKTANKSHRDRIEDFNQYLANMSEHYDIPKVGPG
Predicted Coding Sequence 
TGCAAAAAATTTATGCAAGATCCAATGGAAATTTATGTTGACGATGAGGCAAAGTTGACCCTTCATGGACTTGTACCAGXCATTACCATC
AAATTGAGTGAAACGGAGAAAAACCGGAAGCTAAATGATCTGCTGGATGCCTTGGACCTTCAATCAAGTGGAATATTTGTCAAGAGTGTG
AACAGGGCAGCAGAGCTGAATAAATTACTAGCGGAGTGTAATTTTCCATCTATCTGCATCCACTCTGGCATGACTXCAGGAGGAAAGATT
GACCGCTACAAAGCTTTCAAGGAGGGTCATAAGAGAATTCTTGTGGCAACTGATTTGGTTGGTAGGGGCATTGACATTGAAAGGGTTAAC
ATTGTTATTAACTATGACATGCCAGATTCTGCAGACACTTACCTTCACAGAGTGGGTAGAGCTGGTAGGTTTGGGACGAAAGGCCTTGCC
ATTACATTTGTGTCCTCTGCGTCAGATTCTGAAGTTCTTAATCAGGTTCAGGAAAGGTTTGAAGTAGACATAAAAGAGCTTCCTGAGCAG
ATTGATACTTCTACGTACATGCCATCTTATGATATGAGAGXTGTCCTGGCGGATATTAGTATCATTTTGCCTGAAGATAAGGGGAAACTG
AAGATGTTTGCTTTAGTTTATCGCCTATCTTGGCCTTTTGGACCTTCTATTTTGAAGGAATGGTGGCCTCCTACTCTTGCTTTTGACTCT
GCTGGACTGCTGTACCTTAAXTTGAACCATGCTGTTTCTTATCAGTTAGAGGAACATGACAAATGTCTCTTGAGTGTTATCTTGTTTAGC
TCTAAATTTATACTTCTCAATGATTTAAAAACAAACATAAAAGATATAAAXCTCGAGACGAGAGAGAGGATCGACATGCATAAGATGGCC
AAGACTGCTAATAAATCACATCGTGACCGAATTGAAGATTTCAATCAGTACTTGGCAAACATGAGTGAGCACTATGACATTCCCAAAGTT
GGCCCTGGCTAA\
Edits in Original Sequence 
(5')TGCAAAAAATTTATGCAAGATCCAATGGAAATTTATGTTGACGATGAGGCAAAGTTGACCCTTCATGGACTTGTACCAGXCATTAC
CATCAAATTGAGTGAAACGGAGAAAAACCGGAAGCTAAATGATCTGCTGGATGCCTTGGACCTTCAATCAAGTGGtAATATTTGTCAAGA
GTGTGAACAGGGCAGCAGAGCTGAATAAATTACTAGCGGAGTGTAATTTTCCATCTATCTGCATCCACTCTGGCATGACTXCAGGAGGAA
AGATTGACgCGCTACAAAGCTTTCAAGGAGGGTCATAAGAGAATTCTTGTGGCAACTGATTTGGTTGGTAGGGGCATTGACATTGAAAGG
GTTAACATTGTTATTAACTATGACATGCCAGATTCTGCAGACACTTACCTTCACAGAGTGGGTAGAGCTGGTAGGTTTGGGACGAAAGGC
CTTGCCATTACATTTGTGTCCTCTGCGTCAGATTCTGAAGTTCTTAATCAGGTTCAGGAAAGGTTTGAAGTAGACATAAAAGAGCTTCCT
GAGCAGATTGATACTTCTACGTACATGCCATCTTAgTGATATGAGAGXTGTCCTGGCGGATATTAGTATCATTTTGCCTGAAGATAAGGG
GAAACTGAcAGATGTTTGCTTTAGTTTATCGCCTATCTTGGCCTTTTGGACCTTCTATTTTGAAGGAATGGTGGCCTCCTACTCTaTGCT
TTTGACTCTGCTGGACTGCTGTACCTTAAXTTGAACCATGCTGTTTCTTATCAGTTaAGAGGAACATGACAAATGTCTCTTGAGTGTTAT
CTTGTTTAGCTCTAtAATTTATACTTCTCAATGATTTAAAAACAAACATAAAAGATATAAAXCTCGAGACGAGAGAGAGGATCGACATGC
ATAAGATGGCCAAGACTGCTAATAAATCACATCGTGACCGAATTGAAGATTTCAATCAGTACTTGGCAAACATGAGTGAGCACTATGACA
TTCCCAAAGTTGGCCCTGGCTAA\(3')TTAAGAACAAATCAGAAATTTGCTGCTGGATCTCCATGTCTCCTTTACAGTTGTTTCGCGTT
AGCATCTGTACTAGCTACTATTTTGCATGTACTCTGTAATTTAGATGTTCCCTTGGTTCGATGGTCTTTGCATGATCATCTTCCTTCTGA
GGCTGAACCTCGCAATGATGTTCTAATGGATGTAAATTTTCAGATTGTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan