Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U214519

Score 
331
Direction 
Forward
Predicted Peptide Sequence 
MALGGGGPQRGTAAAAAANLRRRKTGGAGGAAGGAGGTMLQFYTDDSPGLKISPNVXACDEYWLHSLCCDPSLMGKLYFVXQGGLVTEPL
LSWEIFVGQHLSSFKEKXDIVAYFLVCLSNAMESIEKFSSYESIFSCAIPTLSNEQEGPNSSFLDREWDHVRSYSFNRNDFS
Predicted Coding Sequence 
ATGGCATTGGGTGGAGGTGGACCACAAAGAGGGACTGCAGCAGCAGCAGCTGCTAACCTACGTCGAAGGAAGACAGGAGGAGCAGGTGGA
GCTGCAGGAGGAGCAGGTGGTACCATGCTTCAATTCTACACTGATGATTCCCCCGGACTCAAGATATCCCCCAATGTTGXTGCTTGTGAT
GAGTATTGGCTTCATAGCCTTTGTTGCGATCCTTCACTCATGGGTAAGCTCTACTTTGTCCXGCAGGGAGGGCTAGTGACCGAACCGTTG
CTGAGTTGGGAAATTTTTGTTGGACAACATCTTTCATCGTTTAAGGAAAAACXTGACATTGTAGCTTATTTTCTTGTTTGTTTGTCTAAT
GCTATGGAGTCTATAGAAAAGTTTTCTAGTTATGAGTCGATTTTTTCTTGTGCTATTCCAACACTTTCTAATGAACAAGAAGGTCCAAAT
TCTAGTTTCTTAGACCGTGAATGGGATCATGTTCGCAGTTATAGCTTTAACAGAAATGACTTCTCC\
Edits in Original Sequence 
CAAAATACTTCTCATCCATTTTCCTTCCAGATCGGAGAATCCATTTTCCCTAATTCTCAGCATTCTTAAGTGACTAGAA(5')ATGGCAT
TGGGTGGAGGTGGACCACAAAGAGGGACTGCAGCAGCAGCAGCTGCTAACCTACGTCGAAGGAAGACAGGAGGAGCAGGTGGAGCTGCAG
GAGGAGCAGGTGGTACCATGCTTCAATTCTACACTGATGATTCCCCCGGACTCAAGATATCCCCCAATGTTGXTGCTTGTGATGAGTATT
GGCTTCATAGCCTTTGTTGCGATCCTTCACgTCATGGGTAAGCTCTACTTTGTCCXGCAGGGAGGGCTAGTGACCGAACCGTTGCTGAGT
TGGGAAATTTTTGTTGGACAACATCTTTCATCGTTTAAGGAAAAACXTGACATTGTAGCtTTATTTTCTTGTTTGTTTGTCTAATGCTAT
GGAGTCTATAGAAAAGTTTTCTAGTTATGAGTCGATTTTTTCTTGTGCTATTCCAACACTTTCTAATGAACAAGAAGGTgCCAAATTCTA
GTTTCTTAGACCGTGAATGGGATCATGTTCGCAGTTATAGCTTTAACAGAAATGACTTCTCC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan