ESTScan Details for Unigene SGN-U214562

Score 
841
Direction 
Forward
Predicted Peptide Sequence 
MAAASTSPSLFPATRSASNTNTSPSVSNIYATSFMGAALENILSSYKETSKDPWGIVAAAVATSPAEEIKEYVLPSWAKFDLGISPVYWK
TMNGLPPTAGERLKLFYNPAASNMVPNEDFGIAFNGGFNQPIMCGGEPRIMLEKIRGKADPPIYTIQLCIPKHALSLIFSFTNGIEWDGP
YRLQFQVPKAWRNKPTEFFTEGLTQELSQEGACDRAIFPDSSILITRCAMVGNLNVDGGDRCNLDLVPGCIDPDSPQYNPLANVDDGSCP
PYSDSED
Predicted Coding Sequence 
ATGGCTGCAGCATCAACAAGTCCCTCTTTATTTCCTGCAACTCGTTCTGCTTCTAATACTAATACAAGTCCCTCTGTTTCAAATATTTAT
GCTACAAGTTTTATGGGCGCXGCACTTGAGAACATATTATCCAGCTACAAGGAAACTAGTAAGGATCCATGGGGTATAGTTGCTGCGGCA
GTTGCAACTTCCCCTGCAGAGGAAATCAAAGAATATGTGCTTCCTTCATGGGCTAAATTTGACCTTGGAATATCACCAGTATATTGGAAA
ACAATGAATGGTCTTCCTCCAACTGCAGGAGAGAGACTGAAGCTTTTTTACAATCCAGCTGCAAGCAATATGGTACCTAATGAAGATTTT
GGAATCGCGTTTAATGGAGGTTTTAACCAGCCTATCATGTGTGGAGGTGAGCCTAGGATAATGCTCGAGAAAATCAGAGGAAAAGCCGAC
CCTCCTATTTATACGATTCAGTTATGTATTCCCAAGCATGCTCTTAGTTTGATCTTCTCATTCACAAATGGAATCGAATGGGATGGTCCC
TATAGACTACAATTTCAAGTCCCCAAGGCTTGGAGAAATAAACCAACTGAATTCTTCACTGAGGGTCTTACACAGGAGTTGAGCCAGGAG
GGTGCCTGTGACAGGGCAATCTTCCCGGACTCGAGTATCTTGATCACAAGATGTGCTATGGTTGGTAACTTGAATGTGGATGGAGGTGAT
CGTTGCAATCTTGATCTAGTACCGGGATGCATTGATCCAGATTCTCCCCAGTATAATCCACTAGCCAATGTAGATGATGGATCTTGTCCA
CCATATTCAGATTCTGAGGATTAA\
Edits in Original Sequence 
TCGTGCCGAATTCGGCACGAGAA(5')ATGGCTGCAGCATCAACAAGTCCCTCTTTATTTCCTGCAACTCGTTCTGCTTCTAATACTAAT
ACAAGTCCCTCTGTTTCAAATATTTATGCTACAAGTTTTATGGGCGCXGCACTTGAGAACATATTATCCAGCTACAAGGAAACTAGTAAG
GATCCATaGGGGTATAGTTGCTGCGGCAGTTGCAACTTCCCCTGCAGAGGAAATCAAAGAATATGTGCTTCCTTCATGGGCTAAATTTGA
CCTTGGAATATCACCAGTATATTGGAAAACAATGAATGGTCTTCCTCCAACTGCAGGAGAGAGACTGAAGCTTTTTTACAATCCAGCTGC
AAGCAATATGGTACCTAATGAAGATTTTGGAATCGCGTTTAATGGAGGTTTTAACCAGCCTATCATGTGTGGAGGTGAGCCTAGGATAAT
GCTCGAGAAAATCAGAGGAAAAGCCGACCCTCCTATTTATACGATTCAGTTATGTATTCCCAAGCATGCTCTTAGTTTGATCTTCTCATT
CACAAATGGAATCGAATGGGATGGTCCCTATAGACTACAATTTCAAGTCCCCAAGGCTTGGAGAAATAAACCAACTGAATTCTTCACTGA
GGGTCTTACACAGGAGTTGAGCCAGGAGGGTGCCTGTGACAGGGCAATCTTCCCGGACTCGAGTATCTTGATCACAAGATGTGCTATGGT
TGGTAACTTGAATGTGGATGGAGGTGATCGTTGCAATCTTGATCTAGTACCGGGATGCATTGATCCAGATTCTCCCCAGTATAATCCACT
AGCCAATGTAGATGATGGATCTTGTCCACCATATTCAGATTCTGAGGATTAA\(3')CTTTCAGTACATATATACGACTCGTGATGTTTA
TAGTTTAGTGTTATCGATGGAAGTCTTTCACACGTGCGTGTATTCGATTTCAACTATTTACCTTTGTGATAAAGAAAATGTGTAGAATTA
CTAAAAGGAATGAATCTCCAACCTTATACTGTAAAAAAAAAAAAAAAATGGTGTCTTTACTAGTTGGTTTGTAATTTGTATAGAACTTTG
ATACTTCACTTGTGGCATGCAGCAAAAACAAGCTCTTGATAAAAACTCTTGTATTTTGAATATTTACACCTAGTTCAAAGTGAGTTAATT
TCAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan