ESTScan Details for Unigene SGN-U214634

Score 
964
Direction 
Forward
Predicted Peptide Sequence 
MENQSFSMLSASKPQNGAVIQDSSFQGSESFFRSVLGNMEAIYLNKNPTAKAILELVRSADDDQICYDHFAFRTFGVNGHGIDSMSKFFL
DFGYERREELRFPAKKLKAFWFSPPKVSTSSRGSGVHGPLPRIFISELLVDQLSPEAQEIIKKYTNISHCGKEYAALASAFGILTWEKPS
YSEFQLLARESEYAAWTLVNGYALNHVTISTHRLASNLRSIGNLNQFIEENGFNLNSEGGFLKVSPDGLLLQSSTVADSTFFEFSDGITE
AVPCSYIEFAERLVLPQYKDLPAEKVEEFHRRDGFEVGNADKIFESTSKDQLTRRAAXKVSAKQLDVSLCGANSWHVQLDDYSKIKLLLK
EDDIVAXESIIICNYHKFTLGIYT
Predicted Coding Sequence 
ATGGAAAATCAGAGTTTTTCAATGTTATCTGCTTCTAAACCTCAAAATGGAGCTGTAATTCAAGATTCTTCTTTTCAGGGAAGTGAATCA
TTCTTCAGGAGTGTGTTGGGGAACATGGAAGCCATATATCTGAATAAAAACCCCACTGCTAAGGCTATTTTGGAGCTCGTTCGTTCTGCT
GATGATGATCAAATTTGCTATGATCATTTTGCATTTAGGACATTTGGGGTAAATGGTCATGGCATTGATTCTATGTCAAAGTTCTTCTTA
GATTTTGGTTACGAACGACGAGAGGAGCTGAGATTCCCTGCTAAGAAGTTGAAAGCTTTCTGGTTTTCTCCTCCGAAGGTATCAACTTCC
AGTCGTGGGAGTGGGGTTCACGGGCCATTGCCAAGAATATTTATATCCGAACTTCTTGTTGATCAGCTTAGTCCAGAAGCTCAGGAAATA
ATCAAAAAGTACACTAATATTTCGCACTGTGGAAAAGAATATGCTGCACTTGCAAGTGCATTTGGGATTTTGACATGGGAAAAACCCTCG
TATTCGGAATTTCAACTACTGGCTAGGGAGAGTGAGTATGCTGCCTGGACACTTGTCAATGGATATGCATTGAATCATGTTACCATATCT
ACCCATCGGTTGGCATCAAATCTGAGAAGCATTGGAAATCTAAATCAATTTATCGAAGAAAATGGTTTCAATTTGAACTCTGAAGGGGGT
TTTCTAAAGGTGAGCCCTGATGGTCTTTTGCTGCAAAGTTCAACTGTAGCAGATTCTACCTTTTTCGAATTTTCAGACGGCATTACAGAA
GCAGTACCTTGTTCATACATTGAATTTGCTGAGAGACTTGTACTACCGCAATATAAAGATTTACCAGCAGAAAAGGTGGAGGAGTTTCAC
AGGCGGGACGGGTTTGAAGTTGGAAATGCCGACAAGATATTTGAGAGTACATCCAAGGATCAGTTAACTCGTCGTGCTGCAXTGAAAGTA
AGCGCGAAGCAGTTGGATGTTTCACTCTGTGGAGCTAATTCTTGGCATGTTCAGCTGGATGACTACTCCAAGATTAAACTGTTGTTGAAA
GAAGATGATATTGTAGCTXCTGAAAGTATTATTATCTGTAACTATCACAAATTTACTCTTGGCATATACACCTGA\
Edits in Original Sequence 
AGCATTGGTCCCGATAAACCCATGAAAAAAAATACATTCTTCTTCTCAGTTGATAAAGCCCAATTAAGGAACAATAAACAACCAAAAAAG
ATGTCATCAATGATCAAATTACCATCTTGCATGTTAAGTGTCAATTCATCTTCTTTTTCAATCAAATCATCAATTTTTCCAAAATCCATC
TCTTTCTCCTCTAGCCATATTAATAATTTCAAGAACCCTTTTTTGAACTCTAAAACTCCA
(5')ATGGAAAATCAGAGTTTTTCAATGTT
ATCTGCTTCTAAACCTCAAAATGGAGCTGTAATTCAAGATTCTTCTTTTCAGGGAAGTGAATCATTCTTCAGGAGTGTGTTGGGGAACAT
GGAAGCCATATATCTGAATAAAAACCCCACTGCTAAGGCTATTTTGGAGCTCGTTCGTTCTGCTGATGATGATCAAATTTGCTATGATCA
TTTTGCATTTAGGACATTTGGGGTAAATGGTCATGGCATTGATTCTATGTCAAAGTTCTTCTTAGATTTTGGTTACGAACGACGAGAGGA
GCTGAGATTCCCTGCTAAGAAGTTGAAAGCTTTCTGGTTTTCTCCTCCGAAGGTATCAACTTCCAGTCGTGGGAGTGGGGTTCACGGGCC
ATTGCCAAGAATATTTATATCCGAACTTCTTGTTGATCAGCTTAGTCCAGAAGCTCAGGAAATAATCAAAAAGTACACTAATATTTCGCA
CTGTGGAAAAGAATATGCTGCACTTGCAAGTGCATTTGGGATTTTGACATGGGAAAAACCCTCGTATTCGGAATTTCAACTACTGGCTAG
GGAGAGTGAGTATGCTGCCTGGACACTTGTCAATGGATATGCATTGAATCATGTTACCATATCTACCCATCGGTTGGCATCAAATCTGAG
AAGCATTGGAAATCTAAATCAATTTATCGAAGAAAATGGTTTCAATTTGAACTCTGAAGGGGGTTTTCTAAAGGTGAGCCCTGATGGTCT
TTTGCTGCAAAGTTCAACTGTAGCAGATTCTACCTTTTTCGAATTTTCAGACGGCATTACAGAAGCAGTACCTTGTTCATACATTGAATT
TGCTGAGAGACTTGTACTACCGCAATATAAAGATTTACCAGCAGAAAAGGTGGAGGAGTTTCACAGGCGGGACGGGTTTGAAGTTGGAAA
TGCCGACAAGATATTTGAGAGTACATCCAAGGATCAGTTAACTCGTCGTGCTGCAXTGAAAGTAAGCGCGAAGCAGTTGGATGTTTCgAC
TCTGTGGAGCTAATTCTTGGCATGTTCAGCTGGATGACTACTCCAAGATTAAACTGTTGTTGAAAGAAGATGATATTGTAGCTXCTGAAA
GTATTATTATCTGTAACTATCACAAATTTACTCTTGGCATATACACCTGA\(3')TATATCAATAAATTAGTTTGGATGATAAAGTAGAT
AAAAAAAATAATTAAACACCAATATTGATGTAGTCAGTGCAAAAATAAACTTGTCAATGCTATCCATCTTATGATTTCTCTCGAAAAAAA
A

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan