ESTScan Details for Unigene SGN-U214658

Score 
1002
Direction 
Forward
Predicted Peptide Sequence 
AGKGGQDEYEEATDADWGESLDIGEVENLQNGDISMVLGDEEGQEGNDEEEGGWDLEDLDLPSDADTPKTTSNARSSVFVTPTPGMPVSQ
IWVQKSSLAAEHAAAGNFDTAMRLLSRQLGIRNFSPLKSLFIDLHVGSHTHLLAFSSAPVISVAIERGWSESASPNVRGPPALIFSFAQL
EEKLKASYKATTGGKFSDALRLFLSILHTIPLIVIESRREVDEVKELIVIVKEYVLGLQMELKRKELKDNPIRQQELAAYFTHCNLQLPH
LRLALQNAMSICYKAGNLSSAANFARRLLETNPTNESQARTARQVLQAAEKNMRDVTQLNYDFRNPFTVCGATYVPIYRGQKDVTCPYCG
THFVLSQQGGLCTVCDLAVVGADASGXALLGITDQVISASHAVVFGHVIQQMILVLRLRRSLGMGNYEHVFLWDCISGLYFCFYNFAISF
YRPP
Predicted Coding Sequence 
GCAGGCAAGGGAGGACAAGACGAATATGAAGAGGCTACGGATGCAGACTGGGGTGAGTCATTGGACATCGGTGAGGTGGAAAATCTACAG
AATGGGGACATCAGTATGGTGCTTGGTGATGAGGAAGGACAAGAAGGAAATGATGAGGAGGAGGGAGGATGGGATCTTGAGGATCTGGAT
CTGCCTTCTGATGCAGACACACCTAAGACTACTTCCAATGCTCGTTCTTCTGTGTTTGTCACCCCAACACCTGGCATGCCTGTCAGCCAG
ATTTGGGTCCAAAAATCATCTCTAGCTGCTGAACATGCAGCTGCTGGAAATTTTGATACTGCTATGCGGTTGTTGAGTAGACAACTAGGG
ATTAGGAACTTCTCTCCTTTAAAATCACTGTTTATTGATCTTCATGTGGGTAGCCACACTCATCTGCTTGCCTTTTCCTCGGCGCCGGTC
ATCTCCGTGGCAATTGAGAGAGGTTGGAGTGAGTCAGCTAGTCCTAATGTTCGAGGTCCACCTGCTCTTATATTCAGTTTTGCTCAGTTG
GAGGAAAAACTTAAAGCTTCTTATAAAGCGACTACTGGTGGAAAATTTTCTGATGCACTTAGACTATTCCTGAGCATCCTTCACACCATT
CCTCTGATTGTGATTGAGTCGAGACGAGAAGTGGATGAAGTAAAGGAATTGATTGTCATAGTGAAAGAGTATGTTTTGGGTTTGCAGATG
GAGCTTAAGAGGAAGGAATTGAAAGACAATCCTATTCGCCAGCAGGAACTGGCAGCCTATTTCACTCACTGTAATCTGCAGCTTCCTCAC
TTGAGACTGGCGTTACAGAATGCTATGTCTATCTGCTACAAGGCCGGAAATCTTAGCTCAGCAGCGAACTTTGCTAGAAGACTCTTGGAG
ACCAATCCCACCAATGAAAGCCAAGCCAGAACAGCCCGCCAGGTTCTGCAAGCAGCTGAGAAAAATATGCGAGATGTTACACAGTTGAAT
TATGATTTCAGAAATCCTTTTACAGTGTGTGGGGCAACATATGTCCCGATATACCGGGGTCAGAAGGATGTCACTTGTCCTTACTGTGGT
ACTCATTTTGTACTGTCTCAGCAAGGGGGGCTTTGTACTGTTTGTGATCTTGCAGTTGTTGGAGCTGATGCCTCTGGTXTTGCTTTGCTC
GGCATCACAGATCAGGTGATTTCAGCTTCTCATGCAGTTGTATTCGGCCATGTCATTCAGCAGATGATTCTAGTCTTACGTCTTAGAAGA
AGTCTAGGCATGGGTAATTATGAACATGTTTTTTTATGGGATTGTATCAGCGGTTTATATTTTTGTTTCTATAATTTTGCAATCAGTTTT
TACAGACCACCX\
Edits in Original Sequence 
(5')GCAGGCAAGGGAGGACAAGACGAATATGAAGAGGCTACGGATGCAGACTGGGGTGAGTCATTGGACATCGGTGAGGTGGAAAATCT
ACAGAATGGGGACATCAGTATGGTGCTTGGTGATGAGGAAGGACAAGAAGGAAATGATGAGGAGGAGGGAGGATGGGATCTTGAGGATCT
GGATCTGCCTTCTGATGCAGACACACCTAAGACTACTTCCAATGCTCGTTCTTCTGTGTTTGTCACCCCAACACCTGGCATGCCTGTCAG
CCAGATTTGGGTCCAAAAATCATCTCTAGCTGCTGAACATGCAGCTGCTGGAAATTTTGATACTGCTATGCGGTTGTTGAGTAGACAACT
AGGGATTAGGAACTTCTCTCCTTTAAAATCACTGTTTATTGATCTTCATGTGGGTAGCCACACTCATCTGCTTGCCTTTTCCTCGGCGCC
GGTCATCTCCGTGGCAATTGAGAGAGGTTGGAGTGAGTCAGCTAGTCCTAATGTTCGAGGTCCACCTGCTCTTATATTCAGTTTTGCTCA
GTTGGAGGAAAAACTTAAAGCTTCTTATAAAGCGACTACTGGTGGAAAATTTTCTGATGCACTTAGACTATTCCTGAGCATCCTTCACAC
CATTCCTCTGATTGTGATTGAGTCGAGACGAGAAGTGGATGAAGTAAAGGAATTGATTGTCATAGTGAAAGAGTATGTTTTGGGTTTGCA
GATGGAGCTTAAGAGGAAGGAATTGAAAGACAATCCTATTCGCCAGCAGGAACTGGCAGCCTATTTCACTCACTGTAATCTGCAGCTTCC
TCACTTGAGACTGGCGTTACAGAATGCTATGTCTATCTGCTACAAGGCCGGAAATCTTAGCTCAGCAGCGAACTTTGCTAGAAGACTCTT
GGAGACCAATCCCACCAATGAAAGCCAAGCCAGAACAGCCCGCCAGGTTCTGCAAGCAGCTGAGAAAAATATGCGAGATGTTACACAGTT
GAATTATGATTTCAGAAATCCTTTTACAGTGTGTGGGGCAACATATGTCCCGATATACCGGGGTCAGAAGGATGTCACTTGTCCTTACTG
TGGTACTCATTTTGTACTGTCTCAGCAAGGGGGGCTTTGTACTGTTTGTGATCTTGCAGTTGTTGGAGCTGATGCCTCTGGTXTTGCTTT
GCTCGGCATCACAGATCAGGTGATTTCAGCTTCTCATGCAGTTGTATTCGGCCATGTCATTCAGCAGATGATTCTAGTCTTACGTCTTAG
AAGAAGTCTAGGCATGGGTAATTATGAACATGTTTTTTTATGGGATTGTATCAGCGGTTTATATTTTTGTTTCTATAATTTTGCAATCAG
TTTTTACAGACCgACCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan