Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U214726

Score 
494
Direction 
Forward
Predicted Peptide Sequence 
MGIWEAFLNWLRSLFFKQEMELSLIGLQNAGKTSLVNVIATGGYSEDMIPTVGFNMRKVTKGNVTIKLWDLGGNPDSAVCGRDTVXAVSA
IVYVVDAADPDNLSISSSELHXPAEQAISEWYSIAGAGNKIDKPDSLSKQALTDQMGLKSITDREVCCYMISCKNSTNIDSVIDWLVKHS
KSKS
Predicted Coding Sequence 
ATGGGTATCTGGGAAGCTTTTCTCAATTGGCTTCGAAGCCTCTTCTTTAAGCAGGAAATGGAGCTTTCATTGATAGGATTGCAAAATGCA
GGAAAAACATCTCTTGTAAATGTTATTGCAACTGGTGGATACAGTGAAGACATGATACCAACTGTGGGATTTAACATGCGCAAAGTGACG
AAAGGAAATGTCACTATAAAATTGTGGGACCTTGGAGGCAACCCAGATTCCGCAGTATGTGGGAGAGATACTGTCGXTGCTGTTTCTGCT
ATAGTTTATGTTGTTGATGCTGCTGATCCTGATAACCTCAGCATATCAAGTAGTGAACTCCATGAXCCTGCTGAGCAAGCCATCTCTGAG
TGGTATTCCATTGCTGGTGCTGGAAACAAAATTGACAAGCCTGATTCCCTGTCCAAACAGGCTTTGACTGACCAGATGGGATTGAAATCA
ATAACTGATAGAGAAGTGTGCTGCTATATGATCTCGTGCAAGAATTCCACCAATATTGACTCAGTCATTGATTGGCTTGTTAAGCACTCG
AAATCAAAGAGCTAATGA\
Edits in Original Sequence 
GGGAAAAATACCGAGAGGGTATTTAATTGTGTTGTGTTTGAGAGGGATCTTTCTTCTTTATACTGATATTCAGATCTCTCTCTTTTACGA
TTCTTCGCATCAGCC
(5')ATGGGTATCTGGGAAGCTTTTCTCAATTGGCTTCGAAGCCTCTTCTTTAAGCAGGAAATGGAGCTTTCATT
GATAGGATTGCAAAATGCAGGAAAAACATCTCTTGTAAATGTTATTGCAACTGGTGGATACAGTGAAGACATGATACCAACTGTGGGATT
TAACATGCGCAAAGTGACGAAAGGAAATGTCACTATAAAATTGTGGGACCTTGGAGGtCAACCCAGATTCCGCAGTATGTGGGAGAGATA
CTGTCGXTGCTGTTTCTGCTATAGTTTATGTTGTTGATGCTGCTGATCCTGATAACCTCAGCATATCAAGTAGTGAACTCCATGAXCCTG
CTGAGCAAGCCATCTCTGAGTGGTATTCCATTGCTGGTGCTgGGAAACAAAATTGACAAGCCTGATTCCCTGTCCAAACAGGCTTTGACT
GACCAGATGGGATTGAAATCAATAACTGATAGAGAAGTGTGCTGCTATATGATCTCGTGCAAGAATTCCACCAATATTGACTCAGTCATT
GATTGGCTTGTTAAGCACTCGAAATCAAAGAGCTAATGA\(3')TGACTATAACTTTTTTTTTTTGTAGTGGTGCTGATTTGTATGATAA
ATTTGCGAGGCTATTGGTTTTTTCTGCTGGTTTCTCCAGAGTTCTCTTGTACTGTAAATTAAGTTATTTTGTCTATTGAGTGAGTTGTTA
CATGTTTTTTTTCTTGCCATTTTTCGTCTCAACTCTCTCTAATTGTGTTTGCAATTCCTCTTATACTTTTTACTTGTCTGCTGCACGAGT
TTGTGTGAAAGGAACGGATCTTTTTAAGTTTTAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan