ESTScan Details for Unigene SGN-U214730

Score 
1201
Direction 
Forward
Predicted Peptide Sequence 
EAINAQEIITKKAEXLAEKHGIWKEEYSGSATTLPFFPVFFDFSKKLPSSDCSLLPHNHYWISSKRIVTPNGTISGAVEIKEGRIISVVA
EENWHVNSRFTTVVNYRESVVMPGFIDVHAHLDDPGRSEWEGFPSGTKAAAAGGVTTLVDMPLNSAPSTVSEETLKLKVQAAEGRVYVDV
GFWGGLVPENAENTSSLERLLNAGVLGLKSFMVPSGINDFPMTTASHIKEALPTLARYKRPLLVHAEVLVDLDEKVELEDGVENARSYST
YLKTRPASMEEAAINQLITLSKDARAGGSAEGAHLHIVHLSDARTSLNLIKEAKQRGDSITVETCPHYLAFAAEDIPDGDTRFKCAPPIR
DAANKEKLWDALLDGDIDMLSSDHSPSVPEMKLLDEGDFLKAWGGISSLQFVLPVTWTHGRKYGITYEQLASWWSEKPAKLAGLTTKGAI
AVGNQADIVVWEPDMEFDLDNDYPVHIKHPSISAYMGSRLSGKVLATFVGGNLVYKEGNHASQACALPILHXIVSXYEPIGWRRPHGMTV
DGIDNTVIXDQNKSLHGSKLFIVLTLLLGVQQGW
Predicted Coding Sequence 
XTGGAAGCCATTAATGCACAAGAGATCATCACAAAGAAGGCTGAGGXGTTAGCAGAGAAACATGGAATCTGGAAAGAAGAGTACTCTGGC
TCTGCTACCACTCTTCCTTTCTTTCCTGTTTTCTTTGATTTCTCAAAAAAGCTTCCCTCAAGTGACTGCAGCCTTCTGCCTCATAATCAC
TATTGGATATCCAGCAAACGTATTGTGACTCCAAACGGGACAATTTCCGGTGCAGTTGAGATAAAGGAAGGAAGAATTATATCTGTTGTT
GCTGAAGAGAATTGGCATGTAAATTCTCGGTTTACCACAGTGGTCAATTATAGGGAGTCTGTGGTCATGCCTGGATTTATTGATGTGCAT
GCCCATCTTGATGATCCTGGAAGATCAGAATGGGAAGGGTTTCCTTCAGGAACAAAAGCAGCTGCTGCAGGTGGAGTAACCACATTAGTT
GACATGCCTCTTAATAGTGCTCCATCAACAGTTTCTGAAGAGACTTTAAAACTTAAGGTACAGGCTGCAGAAGGGAGGGTCTACGTGGAT
GTTGGTTTCTGGGGAGGTTTGGTTCCAGAAAATGCAGAAAATACAAGTTCTCTGGAAAGACTTCTAAATGCAGGGGTTCTGGGATTGAAG
TCTTTTATGGTGCCATCAGGCATCAATGACTTTCCCATGACAACTGCATCCCACATAAAGGAGGCACTCCCAACTCTGGCTCGATACAAA
AGACCCCTACTTGTTCATGCCGAAGTGCTAGTAGATCTTGATGAAAAAGTGGAGCTGGAGGATGGGGTAGAGAATGCTAGATCATACTCT
ACATATCTCAAGACCAGGCCTGCTTCAATGGAAGAGGCTGCTATCAATCAGCTCATAACACTGTCAAAGGACGCGAGGGCTGGTGGTTCT
GCTGAAGGAGCTCATCTCCATATTGTTCATCTATCTGATGCTAGAACTTCACTAAACCTCATTAAGGAAGCCAAACAAAGGGGTGATAGC
ATCACCGTTGAAACTTGCCCCCATTATCTCGCTTTTGCAGCTGAAGATATTCCTGATGGAGATACTCGGTTTAAGTGTGCTCCACCCATT
CGTGATGCAGCCAATAAAGAAAAACTATGGGATGCGTTACTGGATGGAGATATTGACATGTTAAGTTCTGACCACTCGCCTTCTGTGCCA
GAAATGAAACTCTTAGATGAGGGAGACTTCTTGAAAGCATGGGGTGGCATATCTTCCTTACAGTTTGTTCTACCCGTGACATGGACACAT
GGGCGTAAGTATGGAATAACATATGAGCAGTTGGCTTCTTGGTGGAGTGAGAAGCCTGCCAAACTTGCAGGTCTAACGACTAAGGGGGCA
ATTGCTGTGGGGAACCAAGCAGATATAGTTGTTTGGGAGCCAGACATGGAGTTCGACCTGGATAATGACTACCCTGTACATATTAAGCAC
CCTAGTATATCCGCATACATGGGATCAAGACTCTCTGGGAAAGTTTTGGCAACCTTTGTGGGCGGAAATCTGGTATACAAGGAGGGAAAT
CATGCTTCTCAAGCATGCGCTCTCCCAATTCTTCATAAXATAGTTAGTGXCTACGAGCCTATTGGTTGGAGACGACCACATGGCATGACT
GTAGATGGAATTGATAACACTGTCATTXCAGATCAAAACAAATCTTTGCATGGATCTAAGTTGTTCATCGTCTTAACTCTTCTTTTAGGC
GTGCAACAGGGCTGG\
Edits in Original Sequence 
(5')XTGGAAGCCATTAATGCACAAGAGATCATaCACAAAGAAGGCTGAGGXGTTAGCAGAGAAACATGGAATCTGGAAAGAAGAGTACT
CTGGCTCTGCTACCACTCTTCCTTTCTTTCCTGTTTTaCTTTGATTTCTCAAAAAAGCTTCCCTCAAGTGACTGCAGCCTTCTGCCTCAT
AATCACTATTGGATATCCAGCAAACGTATTGTGACTCCAAACGGGACAATTTCCGGTGCAGTTGAGATAAAGGAAGGAAGAATTATATCT
GTTGTTGCTGAAGAGAATTGGCATGTAAATTCTCGGTTTACCACAGTGGTCAATTATAGGGAGTCTGTGGTCATGCCTGGATTTATTGAT
GTGCATGCCCATCTTGATGATCCTGGAAGATCAGAATGGGAAGGGTTTCCTTCAGGAACAAAAGCAGCTGCTGCAGGTGGAGTAACCACA
TTAGTTGACATGCCTCTTAATAGTGCTCCATCAACAGTTTCTGAAGAGACTTTAAAACTTAAGGTACAGGCTGCAGAAGGGAGGGTCTAC
GTGGATGTTGGTTTCTGGGGAGGTTTGGTTCCAGAAAATGCAGAAAATACAAGTTCTCTGGAAAGACTTCTAAATGCAGGGGTTCTGGGA
TTGAAGTCTTTTATGGTGCCATCAGGCATCAATGACTTTCCCATGACAACTGCATCCCACATAAAGGAGGCACTCCCAACTCTGGCTCGA
TACAAAAGACCCCTACTTGTTCATGCCGAAGTGCTAGTAGATCTTGATGAAAAAGTGGAGCTGGAGGATGGGGTAGAGAATGCTAGATCA
TACTCTACATATCTCAAGACCAGGCCTGCTTCAATGGAAGAGGCTGCTATCAATCAGCTCATAACACTGTCAAAGGACGCGAGGGCTGGT
GGTTCTGCTGAAGGAGCTCATCTCCATATTGTTCATCTATCTGATGCTAGAACTTCACTAAACCTCATTAAGGAAGCCAAACAAAGGGGT
GATAGCATCACCGTTGAAACTTGCCCCCATTATCTCGCTTTTGCAGCTGAAGATATTCCTGATGGAGATACTCGGTTTAAGTGTGCTCCA
CCCATTCGTGATGCAGCCAATAAAGAAAAACTATGGGATGCGTTACTGGATGGAGATATTGACATGTTAAGTTCTGACCACTCGCCTTCT
GTGCCAGAAATGAAACTCTTAGATGAGGGAGACTTCTTGAAAGCATGGGGTGGCATATCTTCCTTACAGTTTGTTCTACCCGTGACATGG
ACACATGGGCGTAAGTATGGAATAACATATGAGCAGTTGGCTTCTTGGTGGAGTGAGAAGCCTGCCAAACTTGCAGGTCTAACGACTAAG
GGGGCAATTGCTGTGGGGAACCAAGCAGATATAGTTGTTTGGGAGCCAGACATGGAGTTCGACCTGGATAATGACTACCCTGTACATATT
AAGCACCCTAGTATATCCGCATACATGGGATCAAGACTCTCTGGGAAAGTTTTGGCAACCTTTGTGGGCGGAAATCTGGTATACAAGGAG
GGAAATCATGCTTCTCAAGCATGCGCTCTCCCAATTCTTCATAAXATAGTTAGTGXCTACGAGCCTATTGGTTGGAGACGACCACATGGC
ATGACaTGTAGATGGAATTGATAACACTGTCATTXCAGATCAAAACAAATCTTTGCATGGATCTAAGTTGTTCATCGTCTTAACTCTTCT
TTTAGGCGTGCAACAGGGCTGG\(3')AGTGTATATAATCTGTTGTACGCCCTTAGTTGATAGTCATTCGATATTTAACTCTGTAGAAAA
TAAATATGTCACTTTAAGCTGAAAGCTCTTGTTGTTGATGAAGTACACATTAAGACTTGAATACATCTTCATAGTTACAAATTCCATGAG
AAACTAATATCAACTTAATTTTGTCTTTCTAGCCAAATTTGATTTGAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan