ESTScan Details for Unigene SGN-U214767

Score 
681
Direction 
Forward
Predicted Peptide Sequence 
NSSPSPSASFPFHTVSANGQNSQDSKQPAVSSAEMDGVEKVFRKFDANGDGKISLSELGAILNALGSKTSPDEVNRIMLEVDTDGDGFID
LKEFAAFYCPRGADGDNKELREAFDLYDKDKNGKITAAELHSVMKSLGEKCSLKDCRRMISKVDVDGDGCVNFEEFKKMMSXDVTFRIIT
YGINGRFICNRFRNSVDTASVSAIVFAVNPXLTVVRYEEIPNQQKTLLLSYLIWDYDNSKKVRKYFAKIKISLKTSTIESPAFYNNKEIF
LFFSISIKNFNFNMAASNYLNRFPFKKFPVTTIPXSLANSWGGGILLSDIIFDCARRLFTFLSFAETQVCEKHDTPKKLSEKLVDGSLNR
EEVEMVMANLGIFANPEGVKIQERLDIFELFGEELEAKEQEVREAFDVFDENKDGFIDERDLQRVLCALGLKGVAELDNCKKMIMAFDEN
GDGRIDFQEFVKML
Predicted Coding Sequence 
XXAAACTCTTCCCCTTCCCCTTCCGCATCTTTTCCCTTCCATACTGTCTCCGCAAATGGCCAAAACTCCCAGGACTCCAAACAGCCGGCA
GTTTCATCGGCGGAGATGGACGGAGTCGAGAAGGTATTCAGGAAGTTTGACGCCAATGGCGACGGAAAAATCTCTCTATCGGAGCTTGGC
GCGATTCTGAATGCACTTGGCAGTAAGACGTCGCCGGATGAGGTAAATAGAATAATGTTGGAAGTTGATACTGATGGGGATGGTTTTATT
GACTTGAAAGAGTTTGCTGCTTTTTACTGTCCGCGAGGAGCGGACGGTGATAATAAGGAGCTTCGGGAGGCTTTCGACTTGTATGATAAG
GACAAAAACGGCAAAATCACAGCGGCTGAATTGCATTCTGTTATGAAGAGCCTCGGAGAGAAGTGCTCGCTCAAGGATTGCCGTCGTATG
ATCAGCAAGGTGGATGTTGACGGCGATGGATGCGTTAACTTTGAGGAGTTTAAGAAGATGATGAGTAGXGACGTGACTTTTCGGATCATA
ACTTATGGAATCAACGGTAGGTTTATTTGCAACCGATTTCGGAACTCTGTAGATACXGCTTCTGTTTCTGCCATCGTTTTTGCTGTCAAT
CCAXCTCTAACTGTAGTTAGGTATGAAGAAATTCCGAATCAGCAAAAAACTTTATTATTATCCTATTTGATTTGGGATTATGATAATTCA
AAAAAGGTAAGAAAATACTTTGCAAAAATAAAAATTAGTCTTAAGACATCTACTATTGAGTCACCCGCCTTTTACAACAACAAAGAGATA
TTTCTCTTCTTCTCCATCTCAATCAAGAACTTTAATTTTAATATGGCAGCTTCTAATTATTTGAATCGATTTCCATTCAAGAAATTCCCT
GTAACTACTATTCCAGXTTCCCTTGCTAATTCATGGGGCGGTGGGATTCTTCTTTCTGATATAATCTTTGATTGTGCACGAAGACTTTTT
ACCTTTTTGTCCTTTGCTGAAACCCAAGTGTGTGAAAAACACGACACTCCCAAAAAACTGAGCGAGAAATTAGTTGATGGAAGCTTAAAC
AGGGAAGAGGTGGAAATGGTTATGGCTAATTTAGGTATTTTTGCCAATCCTGAAGGTGTGAAGATTCAGGAGAGGTTGGACATTTTTGAA
CTTTTCGGAGAGGAATTAGAAGCTAAAGAGCAAGAAGTAAGAGAAGCTTTTGATGTGTTTGACGAGAACAAAGATGGATTTATTGATGAA
AGGGATTTGCAGAGAGTTCTGTGTGCTCTGGGATTAAAGGGTGTTGCAGAATTGGATAATTGCAAGAAGATGATCATGGCCTTTGATGAA
AATGGAGATGGAAGAATCGATTTCCAGGAATTTGTCAAAATGTTGTAA\
Edits in Original Sequence 
(5')XXAAACTCTTCCCCTTCCCCTTCCGCATCTTTTCCCTTCCATACTGTCTCCGCAAATGGCCAAAACTCCCAGcGACTCCAAACAGC
CGGCAGTTTCATCGGCGGAGATGGACGGAGTCGAGAAGGTATTCAGGAAGTTTGACGCCAATGGCGACGGAAAAATCTCTCTATCGGAGC
TTGGCGCGATTCTGAATGCACTTGGCAGTAAGACGTCGCCGGATGAGGTAAATAGAATAATGTTGGAAGTTGATACTGATGGGGATGGTT
TTATTGACTTGAAAGAGTTTGCTGCTTTTTACTGTCCGCGAGGAGCGGACGGTGATAATAAGGAGCTTCGGGAGGCTTTCGACTTGTATG
ATAAGGACAAAAACGGCAAAATCACAGCGGCTGAATTGCATTCTGTTATGAAGAGCCTCGGAGAGAAGTGCTCGCTCAAGGATTGCCGTC
GTATGATCAGCAAGGTGGATGTTGACGGCGATGGATGCGTTAACTTTGAGGAGTTTAAGAAGATGATGAGTAGXGACGTGACTTTTCGGA
TCATAACTTATGGAATCAACGGTAGGTTTATTTGCAACCGATTTCGGAACTCTGTAGATACXGCTTCTGTTTCTGCCATCGTTTTTGCTG
TCAATCCAXCTCTAACTGTAGTTAGGTATGAAGAAATTCCGAATCAGCAAAAAACTTTATTATTATCCTATTTGATTTGGGATTATGATA
ATTCAAAAAAGGTAAGAAtAATACTTTGCAAAAATAAAAATTAGTCTTAAGACATCTACTATTGAGTCACCCGCCTTTTACAACAACAAA
GAGATATTTCTCTTCTTCTCCATCTCAATCAAGAACTTTAATTTTAATATGGCAGCTTCTAATTATTTGAATCGATTTCCATTCAAGAAA
TTCCCTGTAACTACTATTCCAGXTTCCCTTGCTAATTCATGGGGCGGTGGGATTCTTCTTTCTGtATATAATCTTTGATTGTGCACGAAG
ACTTTTTACCTTTTTGTCCTTTGCTGAAACCCAAGTGTGTGAAAAACACGACACTCCCAAAAAACTGAGCGAGAAATTAGTTGATGGAAG
CTTAAACAGGGAAGAGGTGGAAATGGTTATGGCTAATTTAGGTATTTTTGCCAATCCTGAAGGTGTGAAGATTCAGGAGAGGTTGGACAT
TTTTGAACTTTTCGGAGAGGAATTAGAAGCTAAAGAGCAAGAAGTAAGAGAAGCTTTTGATGTGTTTGACGAGAACAAAGATGGATTTAT
TGATGAAAGGGATTTGCAGAGAGTTCTGTGTGCTCTGGGATTAAAGGGTGTTGCAGAATTGGATAATTGCAAGAAGATGATCATGGCCTT
TGATGAAAATGGAGATGGAAGAATCGATTTCCAGGAATTTGTCAAAATGTTGTAA\(3')CAACAATCAACACAAACATTTTGTAACATT
CTTTAATTTGTTCCATTTACTCTAATTTTTAAATATCTTTTATACTTATTTATAATTTTTATCTTTTAATATAATTATTTCATGTTTGAA
AATTAGAATTCTTATGATCTAATAAAATTATAGTCTACAAATGTTGATGCAAAAGGAATATCAATTCAACAATAATATCGAACATTTGTT
TTTTAGTTTTATGTTGATTTATACAATTAAAATACATGATCTAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan