ESTScan Details for Unigene SGN-U214772

Score 
1884
Direction 
Forward
Predicted Peptide Sequence 
MDPMKLNQLKQFVEQCKSNPSILSDPSLSFFRDYIENLGAKLPPAAYDTGDYKEKSHAVDASDDEMDDDENDANIKETVEEEEEPEIIES
DIELDESDTVEPDNDEPQKMGDPSVEVTEESRDASQESKAEAMEAISEGKLEDAIEHLTKAVLLNPKSAIMYATRASVYIKMKKPNAAIR
DATAALELNPDSAKGYKSRGIARAMLGQWEAAAKDLHVASKLDYDEEISAVLKKVEPNAHRIEEHRRKYDRLRKEREDRKIERERQRRKA
EAQAAYEKAKKQEESSSRRAGGMPGGFPGGMPGGFPGGMPGFPGGMPGGFPGGMPGGFPGGMPGGFPGGMPGSAPGGMPGGMPGAAPGGM
PGNMDYSKILNDPELMAAFKDPDVMAALQDVMKNPANLAKHQGNPKIAPIIAKMMGKFAGNN
Predicted Coding Sequence 
ATGGACCCGATGAAGTTGAATCAACTGAAGCAATTCGTTGAACAGTGCAAATCCAATCCTTCCATTCTCTCCGATCCTTCTCTTTCATTT
TTCCGTGACTACATTGAGAATCTCGGTGCTAAACTTCCTCCGGCTGCTTACGACACCGGCGATTACAAAGAGAAGTCCCATGCGGTGGAT
GCGAGTGATGATGAGATGGATGATGATGAGAATGATGCTAATATCAAAGAGACAGTTGAAGAAGAGGAGGAGCCTGAGATAATTGAATCT
GATATTGAGCTTGATGAGAGTGACACTGTGGAACCTGACAATGATGAGCCACAGAAGATGGGAGACCCTTCTGTGGAGGTGACTGAAGAA
AGCCGTGATGCTTCTCAGGAGTCCAAAGCTGAGGCCATGGAAGCAATTTCTGAAGGTAAGTTAGAAGATGCAATTGAGCATCTTACGAAG
GCAGTTCTCCTCAATCCTAAATCAGCAATTATGTATGCTACTAGAGCTAGTGTTTATATCAAGATGAAGAAGCCAAACGCTGCCATACGA
GATGCAACTGCAGCATTGGAGTTGAATCCAGATTCTGCTAAAGGTTACAAATCTCGTGGCATTGCCAGAGCCATGCTGGGACAGTGGGAG
GCAGCTGCTAAGGATCTTCATGTGGCTTCGAAGCTGGACTATGATGAGGAAATAAGTGCTGTGCTTAAGAAGGTTGAGCCCAATGCACAT
AGAATTGAAGAACACCGCAGGAAATATGATAGGTTGCGCAAAGAACGAGAAGATAGAAAGATTGAGCGTGAGAGACAACGAAGAAAGGCT
GAAGCTCAGGCTGCTTATGAAAAGGCCAAGAAGCAAGAAGAATCATCAAGTAGGAGAGCTGGTGGCATGCCCGGAGGCTTTCCTGGTGGC
ATGCCCGGAGGCTTTCCTGGTGGCATGCCCGGATTTCCTGGTGGCATGCCCGGAGGTTTTCCTGGTGGCATGCCTGGAGGCTTTCCAGGT
GGCATGCCCGGAGGCTTTCCAGGGGGTATGCCTGGGTCTGCACCTGGAGGAATGCCCGGAGGCATGCCTGGGGCTGCACCTGGAGGAATG
CCCGGTAACATGGACTACAGCAAAATACTGAATGACCCTGAATTAATGGCGGCATTCAAGGATCCAGATGTCATGGCTGCACTGCAAGAT
GTGATGAAGAACCCAGCTAATTTGGCCAAGCATCAAGGAAATCCTAAGATTGCTCCTATTATTGCAAAAATGATGGGCAAGTTTGCTGGA
AATAATTGA\
Edits in Original Sequence 
AGTAATAGAAGCTACTAGAAGAACCTAGTCAGCTCCAGTCCCCTTCCATTTTCCTCGCCTCACTACCAAAAGCTAGGGTTTACAGTTTCT
ACAATTTCAAAATTTTTTGAATCTGTAGTAATCGTATTTGAAGGTAATCGGAAAAAGCT
(5')ATGGACCCGATGAAGTTGAATCAACTG
AAGCAATTCGTTGAACAGTGCAAATCCAATCCTTCCATTCTCTCCGATCCTTCTCTTTCATTTTTCCGTGACTACATTGAGAATCTCGGT
GCTAAACTTCCTCCGGCTGCTTACGACACCGGCGATTACAAAGAGAAGTCCCATGCGGTGGATGCGAGTGATGATGAGATGGATGATGAT
GAGAATGATGCTAATATCAAAGAGACAGTTGAAGAAGAGGAGGAGCCTGAGATAATTGAATCTGATATTGAGCTTGATGAGAGTGACACT
GTGGAACCTGACAATGATGAGCCACAGAAGATGGGAGACCCTTCTGTGGAGGTGACTGAAGAAAGCCGTGATGCTTCTCAGGAGTCCAAA
GCTGAGGCCATGGAAGCAATTTCTGAAGGTAAGTTAGAAGATGCAATTGAGCATCTTACGAAGGCAGTTCTCCTCAATCCTAAATCAGCA
ATTATGTATGCTACTAGAGCTAGTGTTTATATCAAGATGAAGAAGCCAAACGCTGCCATACGAGATGCAACTGCAGCATTGGAGTTGAAT
CCAGATTCTGCTAAAGGTTACAAATCTCGTGGCATTGCCAGAGCCATGCTGGGACAGTGGGAGGCAGCTGCTAAGGATCTTCATGTGGCT
TCGAAGCTGGACTATGATGAGGAAATAAGTGCTGTGCTTAAGAAGGTTGAGCCCAATGCACATAGAATTGAAGAACACCGCAGGAAATAT
GATAGGTTGCGCAAAGAACGAGAAGATAGAAAGATTGAGCGTGAGAGACAACGAAGAAAGGCTGAAGCTCAGGCTGCTTATGAAAAGGCC
AAGAAGCAAGAAGAATCATCAAGTAGGAGAGCTGGTGGCATGCCCGGAGGCTTTCCTGGTGGCATGCCCGGAGGCTTTCCTGGTGGCATG
CCCGGATTTCCTGGTGGCATGCCCGGAGGTTTTCCTGGTGGCATGCCTGGAGGCTTTCCAGGTGGCATGCCCGGAGGCTTTCCAGGGGGT
ATGCCTGGGTCTGCACCTGGAGGAATGCCCGGAGGCATGCCTGGGGCTGCACCTGGAGGAATGCCCGGTAACATGGACTACAGCAAAATA
CTGAATGACCCTGAATTAATGGCGGCATTCAAGGATCCAGATGTCATGGCTGCACTGCAAGATGTGATGAAGAACCCAGCTAATTTGGCC
AAGCATCAAGGAAATCCTAAGATTGCTCCTATTATTGCAAAAATGATGGGCAAGTTTGCTGGAAATAATTGA\(3')GAGCTTTTGGGAT
TTTGTCCGTAGGAATTTCTAGAGTTTGATAGAGAACATGTTGTTTACCGTAAGCTTGTTTTTATCGAGTATAAAGTCATTCTCCAAGATT
GTGTCTAATCCAAGTTTAGTTTCAAACTACAGCTGTCTTCTTTTCTTATAGATTTGTTATTGTTATGTGTATCAACTATTTTTCCTTCTG
GTGACTGATGTTTTGGTATGCAAAAACTGGTTTCTATCTGCAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan