ESTScan Details for Unigene SGN-U214941

Score 
985
Direction 
Forward
Predicted Peptide Sequence 
MEXAGITSAFVRTQFPSVDIPLENEVLSVPNGYNAPQQVHITQGDYDGEAVIISWVTADEPGSSEVRYGLSEGKYDVTVEGTLNNYTFYK
YESGYIHQCLVTGLQYDTKYYYEIGKGDSARNFWFETPPKVDPDASYKFGIIGDLGQTYNSLSTLQHYMASGAKSVLFVGDLSYADRYQY
NDVGVRWDTFGRLVEQSTAYQPWIWSAGNHEIEYFPYMGEVVPFRSFLSRYPTPYRASKSSNPLWYAIRRASAHIIVLSSYSPFVKYTPQ
WHWLKQEFKKVNREKTPWLIVLMHVPIYNSNEAHFMEGESMRSSYERWFVKYKVDVIFAGHVHAYERSYRISNIHYNVSGGDAYPVPDKK
APIYITVGDGGNSEGLASKFRDPQPEYSAFREASYGHSTLDIKNRTHAIYHWNRNDDGNNITTDSFTLHNQYWGSGLAGES
Predicted Coding Sequence 
ATGGAAGXTGCTGGTATAACAAGTGCATTCGTTCGAACTCAGTTTCCGTCTGTTGATATTCCCCTTGAAAATGAAGTACTTTCAGTTCCA
AATGGTTATAACGCTCCACAGCAAGTGCATATTACACAAGGTGACTATGATGGGGAAGCTGTCATTATCTCATGGGTAACTGCTGATGAA
CCAGGGTCTAGCGAAGTGCGATATGGCTTATCTGAAGGGAAATATGATGTTACTGTTGAAGGGACTCTAAATAACTATACATTCTACAAG
TATGAGTCTGGTTACATACATCAGTGCCTTGTAACTGGCCTTCAGTATGACACAAAGTACTACTATGAAATTGGAAAAGGAGATTCTGCA
AGGAATTTTTGGTTTGAAACTCCTCCAAAAGTTGATCCAGATGCTTCTTACAAATTTGGTATCATAGGTGACCTTGGTCAAACATATAAT
TCCCTTTCAACTCTTCAACATTATATGGCTAGTGGAGCAAAGAGTGTCTTGTTTGTCGGAGACCTCTCTTATGCTGACAGATATCAGTAT
AACGATGTTGGAGTCCGTTGGGATACATTTGGCCGCCTAGTTGAACAAAGTACGGCATACCAGCCATGGATTTGGTCTGCTGGGAATCAT
GAGATAGAGTACTTTCCATATATGGGGGAAGTAGTTCCATTCAGATCATTTCTATCTAGATACCCCACACCTTATCGAGCTTCAAAAAGC
AGTAATCCCCTTTGGTATGCCATCAGGAGGGCATCTGCTCACATAATTGTCCTATCAAGCTATTCCCCTTTTGTAAAATATACACCTCAA
TGGCATTGGTTGAAACAGGAATTTAAAAAGGTGAACAGAGAGAAAACTCCTTGGCTTATAGTCCTTATGCATGTTCCTATCTACAACAGT
AATGAAGCTCATTTCATGGAAGGGGAAAGCATGAGATCCTCCTATGAAAGATGGTTTGTCAAATACAAAGTCGATGTGATCTTTGCTGGC
CACGTCCATGCTTATGAAAGATCATATCGTATATCTAATATACACTACAATGTCTCGGGTGGTGATGCTTATCCCGTACCTGATAAAAAA
GCTCCTATTTACATAACTGTTGGTGATGGAGGAAATTCAGAAGGTCTTGCTTCAAAATTTAGAGATCCCCAGCCAGAATATTCTGCTTTC
CGTGAAGCTAGCTATGGTCATTCGACTCTAGATATCAAGAATAGAACACATGCAATCTACCACTGGAACCGAAATGATGATGGAAATAAC
ATTACAACTGACTCATTTACATTGCACAACCAGTATTGGGGAAGTGGTCTTGCAGGAGAAAGTTGA\
Edits in Original Sequence 
AAAAGAACAATTGTTCCTTTGAATATTCATGTGTTTTTTTGAACTTGATTTGTAGTTAATCAACTGTACCCAATTCAAAAAATCATCTTT
TTGATACACCCATTTCAAAAAGATTACATTTTCAGTTCAAAAATATCAATTTTTTTGTCTGGTTCACTCCCTTGTTGTTTTAGCCTTCAA
AGTCAATTATAACTAGTGTTACCTGAGTTCTCTCTGATCGAGCAGTGCTTATCTTGGAAGTTTGTGGAGAGGAGACAATGTTGCTTTGTC
TCTTCTTTTCGTTATCTCTCTTTTCGACATTTATAGACA
(5')ATGGAAGXTGCTGGTATAACAAGTGCATTCGTTCGAACTCAGTTTCC
GTCTGTTGATATTCCCCTTGAAAATGAAGTACTTTCAGTTCCAAATGGTTATAACGCTCCACAGCAAGTGCATATTACACAAGGTGACTA
TGATGGGGAAGCTGTCATTATCTCATGGGTAACTGCTGATGAACCAGGGTCTAGCGAAGTGCGATATGGCTTATCTGAAGGGAAATATGA
TGTTACTGTTGAAGGGACTCTAAATAACTATACATTCTACAAGTATGAGTCTGGTTACATACATCAGTGCCTTGTAACTGGCCTTCAGTA
TGACACAAAGTACTACTATGAAATTGGAAAAGGAGATTCTGCAAGGAATTTTTGGTTTGAAACTCCTCCAAAAGTTGATCCAGATGCTTC
TTACAAATTTGGTATCATAGGTGACCTTGGTCAAACATATAATTCCCTTTCAACTCTTCAACATTATATGGCTAGTGGAGCAAAGAGTGT
CTTGTTTGTCGGAGACCTCTCTTATGCTGACAGATATCAGTATAACGATGTTGGAGTCCGTTGGGATACATTTGGCCGCCTAGTTGAACA
AAGTACGGCATACCAGCCATGGATTTGGTCTGCTGGGAATCATGAGATAGAGTACTTTCCATATATGGGGGAAGTAGTTCCATTCAGATC
ATTTCTATCTAGATACCCCACACCTTATCGAGCTTCAAAAAGCAGTAATCCCCTTTGGTATGCCATCAGGAGGGCATCTGCTCACATAAT
TGTCCTATCAAGCTATTCCCCTTTTGTAAAATATACACCTCAATGGCATTGGTTGAAACAGGAATTTAAAAAGGTGAACAGAGAGAAAAC
TCCTTGGCTTATAGTCCTTATGCATGTTCCTATCTACAACAGTAATGAAGCTCATTTCATGGAAGGGGAAAGCATGAGATCCTCCTATGA
AAGATGGTTTGTCAAATACAAAGTCGATGTGATCTTTGCTGGCCACGTCCATGCTTATGAAAGATCATATCGTATATCTAATATACACTA
CAATGTCTCGGGTGGTGATGCTTATCCCGTACCTGATAAAAAAGCTCCTATTTACATAACTGTTGGTGATGGAGGAAATTCAGAAGGTCT
TGCTTCAAAATTTAGAGATCCCCAGCCAGAATATTCTGCTTTCCGTGAAGCTAGCTATGGTCATTCGACTCTAGATATCAAGAATAGAAC
ACATGCAATCTACCACTGGAACCGAAATGATGATGGAAATAACATTACAACTGACTCATTTACATTGCACAACCAGTATTGGGGAAGTGG
TCTTcGCAGGAGAAAGTTGA\(3')ACAAGAATCATCTGAACTCTGTCATTTCCGAAAGGCCTTTCACTGCGCGATTCTGAGACACAGTT
TCTCAAACATGTTATCAAACTATGTGTCACAGTATGTTGTTTACTATGTTGTAAAATCTATCTACTTTTGTTGCAGAGAGTGGATCCAGC
TATTTTCCCAGTGTATTGGTTCATGTAAAATAAGGATTTGTGCTGTTTATATGACAGCATTATGGAAAGTATAGCTCTTGTAAATTTGAA
ATAGCTACATATTAGATTTTCATTGTTTGTGTTATTTGATTGATATACCTGTCTATTGTCTTACAAAGTTTAACGATATCAAGATCGGAA
GGTATGCGCGAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan