ESTScan Details for Unigene SGN-U214991

Score 
983
Direction 
Forward
Predicted Peptide Sequence 
MAGMRLLPEDPDVAQVRPAAAADLISDDDRSVAADSWSIKSEYGSTLDDEQRHADATEALNYRADYSSDKDEQEGEGVSSMLGFQSYWDA
AYADELTNFREHGHTGEVWFGGDVMENVVSWTKGLCMDICKSHLPNHVADADSEPVGQREIDISGWSVLDIGTGNGLLLQELAKQGFSDL
TGTDYSEGAVDLARSLADRDGFTNVKFLVDDILETKLDKRFQLVMDKGTLDAIGLHPDGPIKRIIYWDSVSRLVAPGGLLVITSCNSTKD
ELVEEVDTLNQRRVACQRPGTVEASVDPPPFRYLDHVRTYPTFTFGGSVGSRVATVAFLRN
Predicted Coding Sequence 
ATGGCCGGGATGAGACTGTTACCGGAGGACCCCGACGTCGCGCAGGTCCGACCAGCGGCAGCAGCCGATCTGATTTCCGACGACGACCGC
TCTGTGGCGGCCGATTCGTGGTCCATAAAGAGCGAATACGGAAGTACTCTCGATGATGAGCAGCGCCACGCTGATGCTACTGAAGCTCTT
AACTACCGAGCCGATTACAGTTCTGACAAGGATGAGCAGGAAGGTGAAGGAGTTTCTTCAATGCTTGGTTTCCAAAGCTATTGGGATGCT
GCTTACGCCGATGAATTGACAAACTTTCGTGAGCATGGTCACACTGGTGAAGTTTGGTTTGGTGGTGACGTTATGGAAAATGTTGTCTCA
TGGACCAAAGGTTTGTGCATGGACATTTGCAAGAGTCATTTGCCAAATCACGTAGCTGATGCCGATTCTGAGCCTGTTGGGCAGCGTGAG
ATTGACATTTCAGGTTGGAGTGTGCTTGATATTGGGACTGGCAATGGTCTGCTTCTCCAAGAGCTTGCTAAACAAGGGTTCTCTGATCTC
ACTGGAACTGACTATAGTGAAGGAGCAGTTGACCTTGCAAGAAGCCTTGCTGATCGTGATGGTTTCACCAATGTCAAGTTCTTGGTTGAT
GACATTCTTGAGACAAAATTGGATAAAAGGTTTCAGCTAGTTATGGATAAGGGGACCTTAGATGCCATTGGATTGCATCCTGATGGTCCT
ATCAAAAGGATTATCTACTGGGACTCTGTTTCAAGGCTTGTCGCTCCTGGTGGATTATTGGTAATTACTTCATGTAATAGTACAAAAGAT
GAATTGGTAGAAGAAGTGGATACTCTCAATCAAAGAAGGGTTGCTTGTCAAAGACCAGGAACAGTCGAAGCCTCAGTAGATCCTCCTCCT
TTCCGCTATCTCGATCACGTTCGCACATATCCTACATTCACATTTGGAGGATCCGTAGGCTCGCGTGTAGCAACTGTAGCATTCCTAAGG
AACTGA\
Edits in Original Sequence 
TCAACTCCTCCAACGTACATCACACTCCTCTCTCTCCCTTCCTCTTCTCTTTAGGGTTTTTCATCTCGATTCATCACAC(5')ATGGCCG
GGATGAGACTGTTACCGGAGGACCCCGACGTCGCGCAGGTCCGACCAGCGGCAGCAGCCGATCTGATTTCCGACGACGACCGCTCTGTGG
CGGCCGATTCGTGGTCCATAAAGAGCGAATACGGAAGTACTCTCGATGATGAGCAGCGCCACGCTGATGCTACTGAAGCTCTTAACTACC
GAGCCGATTACAGTTCTGACAAGGATGAGCAGGAAGGTGAAGGAGTTTCTTCAATGCTTGGTTTCCAAAGCTATTGGGATGCTGCTTACG
CCGATGAATTGACAAACTTTCGTGAGCATGGTCACACTGGTGAAGTTTGGTTTGGTGGTGACGTTATGGAAAATGTTGTCTCATGGACCA
AAGGTTTGTGCATGGACATTTGCAAGAGTCATTTGCCAAATCACGTAGCTGATGCCGATTCTGAGCCTGTTGGGCAGCGTGAGATTGACA
TTTCAGGTTGGAGTGTGCTTGATATTGGGACTGGCAATGGTCTGCTTCTCCAAGAGCTTGCTAAACAAGGGTTCTCTGATCTCACTGGAA
CTGACTATAGTGAAGGAGCAGTTGACCTTGCAAGAAGCCTTGCTGATCGTGATGGTTTCACCAATGTCAAGTTCTTGGTTGATGACATTC
TTGAGACAAAATTGGATAAAAGGTTTCAGCTAGTTATGGATAAGGGGACCTTAGATGCCATTGGATTGCATCCTGATGGTCCTATCAAAA
GGATTATCTACTGGGACTCTGTTTCAAGGCTTGTCGCTCCTGGTGGATTATTGGTAATTACTTCATGTAATAGTACAAAAGATGAATTGG
TAGAAGAAGTGGATACTCTCAATCAAAGAAGGGTTGCTTGTCAAAGACCAGGAACAGTCGAAGCCTCAGTAGATCCTCCTCCTTTCCGCT
ATCTCGATCACGTTCGCACATATCCTACATTCACATTTGGAGGATCCGTAGGCTCGCGTGTAGCAACTGTAGCATTCCTAAGGAACTGA\
(3')ATTATTACTTTCTCATCATTTTGGGTGCATCACTGCACTTTTTTTGTAACGTCGTGCAACCGTGGAGTGTTTCTTTGGGAAGACCA
TTTCTGATTTATGCAAGGTGAAAGATTAATTGATCTAGTTTTTGTATAGGGGGTAACGTTAGTGCTACATTAACAACGTTGATCATCAGA
TGACTCGTGTTAGATGGAAAAATTGTTCTTCAAGTCAATGTTATGTCCCTTTTTTGGGGCCCAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan