ESTScan Details for Unigene SGN-U215046

Score 
937
Direction 
Forward
Predicted Peptide Sequence 
EIDAIRIQKSLNGFPLIKFXVVPMAVFSPTCSSTSPLLSFRNNISFFPSHRPSFPGVRCTLTVKATVSVESPSSSSTDCRDDSPKVLLEV
RDLSAVIVESKQQILNGVNLTVRQGEVHAVMGKNGSGKSTFAKVLVGHPDYEITGGSVSFKGENLLEMEPEERSLAGLFMSFQSPVAIPG
VSNIDFLNMAYNAQRRKLGLPELGPIEFYGYIAPKLELVNMKIDFLNRNVNEGFSGGERKRNEILQLAVLGADLAILDEIDSGLDVDALR
DVAKAVNGLLSPKNSVLMITHYLRLLEFIKPTYIHIMEKGRIVKTGDISIAKVLEKEGYKAISAHRAAMKNDDFVSSAATRGNISTAPTL
FKKVAISDASTFSSNDSKYQCSIVSRFKSKDNCXPPDVGKMTNFDXHGE
Predicted Coding Sequence 
XXTGAGATTGATGCAATCAGAATTCAGAAGTCGTTAAACGGATTTCCACTTATCAAATTTGXTGTTGTTCCTATGGCTGTTTTCAGTCCC
ACTTGTTCTTCTACTTCCCCACTTCTCTCCTTCAGAAACAACATCTCTTTCTTCCCTTCACATCGCCCTTCTTTTCCCGGAGTCCGGTGC
ACTCTCACAGTGAAAGCCACCGTCAGCGTCGAATCTCCGTCGTCTTCCTCCACCGACTGCAGGGATGACTCGCCCAAGGTCTTACTTGAA
GTCCGGGACCTCTCCGCTGTCATAGTCGAGTCAAAGCAGCAAATTCTCAATGGTGTTAACCTCACTGTCCGCCAAGGCGAGGTACATGCT
GTAATGGGTAAGAATGGTTCTGGAAAGAGCACCTTTGCCAAGGTTCTTGTTGGGCATCCAGATTATGAAATTACAGGAGGCAGTGTGTCA
TTTAAAGGTGAGAATCTACTTGAGATGGAACCCGAGGAAAGATCTCTTGCTGGTCTTTTCATGAGCTTCCAGTCCCCAGTTGCCATACCT
GGAGTAAGCAATATTGACTTTCTTAACATGGCGTATAATGCTCAAAGGAGGAAACTTGGACTGCCAGAACTGGGACCAATTGAGTTTTAC
GGGTACATTGCCCCGAAGCTTGAACTTGTCAACATGAAGATAGACTTCTTGAACAGAAATGTAAATGAAGGATTCAGTGGTGGAGAAAGG
AAACGCAATGAGATTCTGCAACTAGCGGTTCTCGGGGCTGACTTGGCAATACTGGATGAGATTGATTCTGGTTTAGATGTTGACGCACTT
CGAGACGTAGCAAAGGCAGTAAATGGACTTCTATCGCCAAAGAATTCAGTGTTGATGATTACTCATTACTTACGATTATTAGAATTCATC
AAGCCGACGTATATCCATATCATGGAGAAAGGGAGAATCGTGAAGACTGGAGACATATCCATAGCTAAAGTTCTGGAGAAAGAAGGGTAC
AAAGCAATTTCTGCCCATAGAGCTGCCATGAAGAATGATGATTTTGTCTCATCAGCTGCTACTAGAGGAAATATTTCTACTGCTCCAACA
TTATTTAAGAAAGTGGCAATTAGTGATGCTTCCACTTTCTCATCAAATGATTCAAAATATCAGTGCTCAATTGTCTCGAGATTTAAGAGT
AAGGATAACTGTGXTCCCCCTGATGTGGGCAAAATGACAAATTTTGATGXACATGGGGAATGA\
Edits in Original Sequence 
(5')XXTGAGATTGATGCAATCAGAATTCAGAAGTCGTTAAACGGATTTCCACTTATCAAATTTGXTGTTGTTCCTATGGCTGTTTTCAG
TCCCACTTGTTCTTCTACTTCCCCACTTCTCTCCTTCAGAAACAACATCTCTTTCTTCCCTTCACATCGCCCTTCTTTTCCCGGAGTCCG
GTGCACTCTCACAGTGAAAGCCACCGTCAGCGTCGAATCTCCGTCGTCTTCCTCCACCGACTGCAGGGATGACTCGCCCAAGGTCTTACT
TGAAGTCCGGGACCTCTCCGCTGTCATAGTCGAGTCAAAGCAGCAAATTCTCAATGGTGTTAACCTCACTGTCCGCCAAGGCGAGGTACA
TGCTGTAATGGGTAAGAATGGTTCTGGAAAGAGCACCTTTGCCAAGGTTCTTGTTGGGCATCCAGATTATGAAATTACAGGAGGCAGTGT
GTCATTTAAAGGTGAGAATCTACTTGAGATGGAACCCGAGGAAAGATCTCTTGCTGGTCTTTTCATGAGCTTCCAGTCCCCAGTTGCCAT
ACCTGGAGTAAGCAATATTGACTTTCTTAACATGGCGTATAATGCTCAAAGGAGGAAACTTGGACTGCCAGAACTGGGACCAATTGAGTT
TTACGGGTACATTGCCCCGAAGCTTGAACTTGTCAACATGAAGATAGACTTCTTGAACAGAAATGTAAATGAAGGATTCAGTGGTGGAGA
AAGGAAACGCAATGAGATTCTGCAACTAGCGGTTCTCGGGGCTGACTTGGCAATACTGGATGAGATTGATTCTGGTTTAGATGTTGACGC
ACTTCGAGACGTAGCAAAGGCAGTAAATGGACTTCTATCGCCAAAGAATTCAGTGTTGATGATTACTCATTACTTACGATTATTAGAATT
CATCAAGCCGACGTATATCCATATCATGGAGAAAGGGAGAATCGTGAAGACTGGAGACATATCCATAGCTAAAGTTCTGGAGAAAGAAGG
GTACAAAGCAATTTCTgGCCCATAGAGCTGCCATGAAGAATGATGATTTTGTCTCATCAGCTaGCTACTAGAGGAAATATTTCTACTGCT
CCAACATTATTTAAGAAAGTGGCAATTAGTGATGCTTCCACtTTTCTCATCAAATGATTCAAAATATCAGTGCTCAATTGTCTCGAGATT
TAAGAGTAAGGATAACTGTGXTCCCCCTGATGTGGGCAAAATGACAAATTTTGATGXACATGGGGAATGA\(3')GTCATATACTTGTAT
TTTATCCTGTCTTTTTTTTCTTCTAAAGATTAGTTTTGTATCGGGAATTATAGTAACTTATTTGGTTGGTTGCTGTCTAAATTCGGTGAG
GGTTCGATTCTCCACCTGTGCCTGATGATCTACTTTATGAGGAGAGGCCTTTTACCTCTTAATTCAGTTGTGTGCAATTGCTTTCTTGGT
CCCTTAGTTACTATAAAATTCTTATTTGGTTTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan