ESTScan Details for Unigene SGN-U215068

Score 
482
Direction 
Forward
Predicted Peptide Sequence 
PALEVAKKXSAVQGARKCTPKLCQSFFRQQPXVSPAQWQPSRGILMTIDVQKPNHEEAVSFFALSKNACYVISTSGGKISXVQHDDIQES
FMPPPPAATYIAFHPQDNNIITIGKSKLKGHSKRIPGLAFSHVLNVLVSSGADFRAVYGALLGGNAEGQILAATVSIDISIRYQSAVHQD
QTHFFVVHDAQLAIYEXNKVEMLKAAVGSVLKYSPISNVKPADTCQFLGCNCVHIHSPYAMPQFKYPPVVAEHLEDPRQYALAMSDSSVN
VSIPLESGG
Predicted Coding Sequence 
XXACCTGCATTGGAAGTGGCTAAGAAATGXAGCGCAGTTCAGGGGGCAAGGAAATGTACACCAAAATTGTGTCAATCTTTCTTTAGGCAA
CAACCAGXTGTTTCACCAGCACAGTGGCAACCTTCAAGAGGCATCTTAATGACAATTGATGTGCAAAAACCAAACCATGAGGAAGCTGTC
TCCTTCTTTGCTTTGTCCAAGAATGCTTGCTATGTGATATCAACATCTGGTGGAAAGATCTCCXTTGTTCAACATGATGACATTCAAGAG
AGTTTCATGCCTCCACCTCCAGCAGCAACTTATATTGCCTTCCATCCTCAAGATAACAACATCATCACTATTGGTAAAAGCAAGCTTAAA
GGGCACTCTAAAAGGATACCTGGCCTTGCCTTCTCTCATGTGCTCAATGTGCTAGTTTCCTCGGGAGCTGATTTCAGAGCTGTGTATGGA
GCACTGTTGGGCGGGAATGCAGAGGGCCAGATCCTTGCAGCTACGGTGTCGATCGATATCTCAATCAGATACCAGAGTGCAGTTCATCAG
GATCAAACTCATTTCTTTGTTGTGCATGACGCACAGCTTGCAATTTATGAAAAXAACAAAGTTGAAATGCTTAAAGCAGCAGTGGGTTCC
GTGCTGAAGTACTCCCCAATTTCTAATGTGAAGCCAGCTGATACATGCCAGTTTCTTGGATGCAACTGTGTGCATATTCACTCTCCATAT
GCGATGCCGCAGTTCAAATATCCACCAGTTGTTGCAGAACATCTAGAAGATCCAAGGCAATATGCACTAGCTATGTCAGATAGCAGTGTT
AATGTTTCCATACCACTTGAATCTGGAGGC\
Edits in Original Sequence 
(5')XXACCTGCATTGGAAGTGGCTAAGAAATGXAGCGCAGTTCAGGGGGCAAGGAAATGTACACCAAAATTGTGTCAATCTTTCTTTAG
GCAACAACCAGXTGTTTCACCAGCACAGTGGCAACCTTCAAGAGGCATCTTAATGACAATTGATGTGCAAAAACCAAACCATGAGGAAGC
TGTCTCCTTCTTTGCTTTGTCCAAGAATGCTTGCTATGTGATATCAACATCTGGTGGAAAGATCTCCXTTGTTCAACATGATGACATTCA
AGAGAGTTTCATGCCTCCACCTCCAGCAGCAACTTATATTGCCTTCCATCCTCAAGATAACAACATCATCACTATTGGtTAAAAGCAAGC
TTAAAGGGCACTCTAAAAGGATACCTGGCCTTGCCTTCTCTCATGTGCTCAATGTGCTAGTTTCCTCGGGAGCTGATTcTCAGAGCTGTG
TATGGAGCACTGTTGGGCGGGAATGCAGAGGGCCAGATCCTTGCAGCTACGGTGTCGATCGATATCTCAATCAGATACCAGAGTGCAGTT
CATCAGGATCAAACTCATTTCTTTGTTGTGCATGACGCACAGCTTGCAATTTATGAAAAXAACAAAGTTGAAATGCTTAAAGCAGCAGTG
GGTTCCGTGCTGAAGTACTgCCCCAATTTCTAATGTGAtAGCCAGCTGATACATGCCAGTTTCTTGGATGCAACTGTGTGCATATTCACT
CTCCATATGCGATGCCGCAGTTCAAATATCCAcCCAGTTGTTGCAGAACATCTAGAAGATCCAAGGCAATATGCACTAGCTATGTCAGAT
AGCAGTGTTAATGTTTCCATACCACTTGAATCTGGAGGC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan