ESTScan Details for Unigene SGN-U215082

Score 
179
Direction 
Forward
Predicted Peptide Sequence 
NNPFLFQFFQTDPTRFTPHMALVRDRRHLNLRLPLPEPSERRPRFPLPLPPSSVPTVNSTASTTTATNTTTTTTASTTTISISELEKLKV
LGHGNGGTVYKVRHKRTSAIYALKVVHGDSDPEIRRQILREISILRRTESPYVIKCHGVIDMPGGDIGILMEYMNAGTLENLLKSQLTFS
ELCLARIAKQVLGGLDYLHSHKIIHRDLKPSNLLVNREMEVKIADFGVSKIMGRTLDPCNSYVGTCAYMSPERFDPDTYGGNYNGYAADI
WSLGLTXNGTVYGPLSVPAAGSAPDWATLMCAICFGEPPSLPENTSEKFNDFMKVAYRKSPEEMERSSTFATSVYTEYRFXNPPKKGKKQ
AKNWNW
Predicted Coding Sequence 
AACAATCCATTTCTCTTCCAATTTTTCCAAACGGATCCGACCCGATTCACCCCTCACATGGCCTTAGTTCGTGATCGCCGACACCTAAAT
CTCCGTCTTCCCTTACCGGAACCCTCCGAACGACGTCCTCGTTTCCCCTTACCTCTCCCTCCATCTTCCGTACCCACCGTCAACTCTACC
GCCAGCACCACCACTGCTACAAATACTACGACGACCACCACTGCTTCTACTACCACTATCTCCATTTCGGAACTTGAAAAGCTTAAGGTT
CTCGGTCATGGAAACGGTGGAACTGTGTATAAAGTCCGTCATAAGCGGACCTCCGCGATCTACGCTCTGAAAGTTGTTCACGGTGATAGT
GACCCAGAGATTCGCCGTCAGATCCTCCGGGAAATCTCAATTCTTCGCCGGACGGAATCTCCTTACGTTATCAAGTGTCATGGAGTTATT
GATATGCCCGGCGGGGATATCGGTATTCTTATGGAGTATATGAACGCCGGTACATTAGAAAATCTACTTAAATCACAATTAACTTTCTCC
GAACTCTGTTTAGCGAGAATCGCTAAGCAAGTGCTTGGTGGATTAGACTATTTGCATAGTCACAAAATCATTCACAGAGATCTAAAACCT
TCGAACCTTTTAGTGAATCGTGAGATGGAGGTGAAAATCGCTGATTTCGGAGTGAGCAAAATCATGGGAAGGACTTTGGATCCTTGCAAT
TCATACGTTGGAACTTGTGCGTATATGAGCCCAGAAAGATTTGATCCAGACACTTATGGAGGTAACTACAATGGTTACGCAGCTGATATA
TGGAGCTTAGGTCTCACTTTXAATGGAACTGTATATGGGCCACTTTCCGTTCCTGCCGCCGGGTCAGCACCGGATTGGGCTACTCTGATG
TGCGCTATATGCTTCGGTGAACCACCAAGTTTGCCGGAAAATACGTCGGAAAAATTCAATGATTTCATGAAGGTTGCTTACAGAAAGAGT
CCAGAAGAGATGGAGCGCTCATCAACTTTTGCAACATCCGTTTATACAGAGTATCGATTTGAXAATCCACCTAAAAAGGGAAAAAAGCAA
GCTAAAAACTGGAATTGG\
Edits in Original Sequence 
(5')AACAATCCATTTCTCTTCCAATTTTTCCAAACGGATCCGACCCGATTCACCCCTCACATGGCCTTAGTTCGTGATCGCCGACACCT
AAATCTCCGTCTTCCCTTACCGGAACCCTCCGAACGACGTCCTCGTTTCCCCTTACCTCTCCCTCCATCTTCCGTACCCACCGTCAACTC
TACCGCCAGCACCACCACTGCTACAAATACTACGACGACCACCACTGCTTCTACTACCACTATCTCCATTTCGGAACTTGAAAAGCTTAA
GGTTCTCGGTCATGGAAACGGTGGAACTGTGTATAAAGTCCGTCATAAGCGGACCTCCGCGATCTACGCTCTGAAAGTTGTTCACGGTGA
TAGTGACCCAGAGATTCGCCGTCAGATCCTCCGGGAAATCTCAATTCTTCGCCGGACGGAATCTCCTTACGTTATCAAGTGTCATGGAGT
TATTGATATGCCCGGCGGGGATATCGGTATTCTTATGGAGTATATGAACGCCGGTACATTAGAAAATCTACTTAAATCACAATTAACTTT
CTCCGAACTCTGTTTAGCGAGAATCGCTAAGCAAGTGCTTGGTGGATTAGACTATTTGCATAGTCACAAAATCATTCACAGAGATCTAAA
ACCTTCGAACCTTTTAGTGAATCGTGAGATGGAGGTGAAAATCGCTGATTTCGGAGTGAGCAAAATCATGGGAAGGACTTTGGATCCTTG
CAATTCATACGTTGGAACTTGTGCGTATATGAGCCCAGAAAGATTTGATCCAGACACTTATGGAGGTAACTACAATGGTTACGCAGCTGA
TATATGGAGCTTAGGTCTCACTTTXAATGGAACTGTATATGGGCCACTTTCCGTTCCTGCCGCCGGGTCAGCgACCGGATTGGGCTACTC
TGATGTGCGCTATATGCTTCGGTGAACCACCAAGTTTGCCGGAAAATACGTCGGAAAAATTCAATGATTTCATGAAGtGTTGCTTACAGA
AAGAGTCCAGtAAGAGATGGAGCGCTCATCAACTTTTGCAACATCCGTTTATACAGAGTATCGATTTGAXAATCCACCTAAAAAGGGAAA
AAAGCAAGCTAAAAACTGGAATTGG\(3')AATCCGAGTTACTGTAAATAGAACGAGATTCTTCTTCTTTTTTTTTTTGGTTCACTTTTT
GTATATTCTTCCACTTTGAATCTGAAATCGAAATCAGAATCATCCTCTGTACTGGAAAAAAATGCTCCATTTCCACAGCTAAAATCATCT
GTGGAATTTTGGGACCTAATGAATTTTAACTTTTCTTCCAGCAACTTAAAAAAAAAAGGCAAAAAAAAATTTTCCTAATTCAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan