ESTScan Details for Unigene SGN-U215131

Score 
1058
Direction 
Forward
Predicted Peptide Sequence 
MDEVKKSEGHMTSPAAFVEGGIQDACDDACSICLEAFCESDPPSELAASMSFISSASWNGVREVLIXPMCWQSISLKDQMSQELFEAVEQ
ERNFRVNAERNATVFQFPALGDFDYSMCVAALKDKHFLFSSVSEFHKLACSVYLYLFFIHGTPVPVDIDDPELEERILQHLAVAASMGRA
HHAGRMEGSRNRSSTNNRPQLLVFPTHHNSSPTASVSPYPTGSLSDPAAITTVDSPLPISSGSSDSPRQMPYLPSVQSDQLSALSSGSVL
TPATAQGLSSGDRSSSSSSFTPIHRRAGPSELQSFSESWRSRFSSMSMKYKESISKNTREWKERLFSRSSSMPDAGPVRRESNVGIASLS
HLMEHLETRENSRAGSVSAVTNIVDSSHTLQRDHGNMGTHIGNGLNRNSTASAASSAQN
Predicted Coding Sequence 
ATGGATGAGGTCAAGAAATCAGAGGGTCATATGACATCCCCTGCAGCTTTTGTGGAAGGAGGAATTCAGGATGCATGTGATGATGCTTGC
AGCATTTGTCTCGAGGCTTTCTGCGAAAGCGATCCTCCCTCGGAACTAGCTGCAAGCATGAGTTTCATCTCCAGTGCGTCCTGGAATGGT
GTCAGAGAAGTTCTAATTGXTCCTATGTGTTGGCAGTCCATAAGTCTGAAAGATCAGATGAGTCAAGAATTGTTTGAGGCTGTGGAACAA
GAAAGGAATTTTAGAGTTAATGCAGAAAGAAATGCTACAGTATTTCAGTTTCCTGCACTGGGAGATTTTGACTACAGCATGTGTGTGGCT
GCCTTAAAGGATAAGCATTTTCTTTTTTCATCTGTTTCTGAGTTTCACAAGCTAGCATGTTCTGTTTACCTCTATTTATTCTTCATTCAT
GGCACTCCAGTTCCTGTGGATATTGATGATCCTGAACTTGAAGAGCGCATTCTTCAGCATTTGGCTGTTGCTGCTTCAATGGGAAGAGCT
CACCATGCGGGTCGAATGGAGGGCTCAAGAAATCGTTCATCCACCAATAACCGTCCACAACTTTTAGTATTTCCAACTCATCATAATTCA
TCTCCTACCGCTTCTGTTTCACCTTATCCTACTGGATCACTTTCTGATCCTGCTGCAATCACAACAGTTGATTCCCCTCTTCCCATTAGC
TCCGGTAGCAGTGATTCACCACGACAGATGCCTTACCTTCCTTCAGTTCAAAGTGATCAACTTTCTGCTTTATCATCTGGTTCCGTTCTA
ACGCCTGCCACAGCACAAGGACTATCTAGTGGTGATAGAAGCTCTTCTAGTTCATCCTTTACACCAATCCATAGGAGAGCTGGACCATCA
GAGTTGCAGTCATTTTCAGAGTCCTGGAGATCTCGATTTAGTTCTATGTCAATGAAATATAAAGAATCGATCTCAAAGAATACACGAGAG
TGGAAGGAGAGATTGTTTTCTCGAAGTTCTTCAATGCCGGATGCTGGTCCTGTTAGGAGAGAGTCAAATGTTGGAATTGCTAGTCTATCT
CACCTGATGGAACATCTGGAAACTCGAGAAAATAGTAGAGCTGGCTCTGTTTCAGCAGTTACTAATATAGTGGATTCTTCACACACACTC
CAAAGAGACCATGGTAATATGGGTACTCATATTGGAAATGGATTGAACAGAAACTCAACAGCTTCTGCTGCAAGTTCAGCTCAGAATTAA
\
Edits in Original Sequence 
GAAAGGGGCCTTATCGGTTCAACAAATTAATTTTCTTCTTCACCCAATTTCCGGAGCCTTTTTCTAAATTCATATCAGGTTTGTAAGGTT
TTTGGGA
(5')ATGGATGAGGTCAAGAAATCAGAGGGTCATATGACATCCCCTGCAGCTTTTGTGGAAGGAGGAATTCAGGATGCATGTG
ATGATGCTTGCAGCATTTGTCTCGAGGCTTTCTGCGAAAGCGATCCTCCCTCGGtAACTAGCTGCAAGCATGAGTTTCATCTCCAGTGCG
TCCTGGAATGGTGTCAGAGAAGTTCTAATTGXTCCTATGTGTTGGCAGTCCATAAGTCTGAAAGATCAGATGAGTCAAGAATTGTTTGAG
GCTGTGGAACAAGAAAGGAATTTTAGAGTTAATGCAGAAAGAAATGCTACAGTATTTCAGTTTCCTGCACTGGGAGATTTTGaACTACAG
CATGTGTGTGGCTGCCTTAAAGGATAAGCATTTTCTTTTTTCATCTGaTTTCTGAGTTTCACAAGCTAGCATGTTCTGTTTACCTCTATT
TATTCTTCATTCATGGCACTCCAGTTaCCTGTGGATATTGATGATCCTGAACTTGAAGAGCGCATTCTTCAGCATTTGGCTGTTGCTGCT
TCAATGGGAAGAGCTCACCATGCGGGTCGAATGGAGGGCTCAAGAAATCGTTCATCCACCAATAACCGTCCACAACTTTTAGTATTTCCA
ACTCATCATAATTCATCTCCTACCGCTTCTGTTTCACCTTATCCTACTGGATCACTTTCTGATCCTGCTGCAATCACAACAGTTGATTCC
CCTCTTCCCATTAGCTCCGGTAGCAGTGATTCACCACGACAGATGCCTTACCTTCCTTCAGTTCAAAGTGATCAACTTTCTGCTTTATCA
TCTGGTTCCGTTCTAACGCCTGCCACAGCACAAGGACTATCTAGTGGTGATAGAAGCTCTTCTAGTTCATCCTTTACACCAATCCATAGG
AGAGCTGGACCATCAGAGTTGCAGTCATTTTCAGAGTCCTGGAGATCTCGATTTAGTTCTATGTCAATGAAATATAAAGAATCGATCTCA
AAGAATACACGAGAGTGGAAGGAGAGATTGTTTTCTCGAAGTTCTTCAATGCCGGATGCTGGTCCTGTTAGGAGAGAGTCAAATGTTGGA
ATTGCTAGTCTATCTCACCTGATGGAACATCTGGAAACTCGAGAAAATAGTAGAGCTGGCTCTGTTTCAGCAGTTACTAATATAGTGGAT
TCTTCACACACACTCCAAAGAGACCATGGTAATATGGGTACTCATATTGGAAATGGATTGAACAGAAACTCAACAGCTTCTGCTGCAAGT
TCAGCTCAGAATTAA\(3')GTGTTCTATTTAAGCATTTACCTGGCATCTGTCCTCAGCATTTCATCTTTGAATGTTATGAACTTTGCTT
GGGGGTTCAAATATGACATGCTGAGGACGAGATATATTTTCGTTCAGTCTATGGAGAGGAGAAGTAATAGCAGTTGCAACATGAATGTGA
TTTGCCTGTAAATTTGTTTATATATACGTTTTAACGCGAATCAAAATGTTGAAATGTATCACTGAAATCTGGTAGAGATCATTGTGTTGG
ATATTTACAAGTTTACAACTTGATAAAATTAACAGAATGATGTTTTTGGTTATTACATAAACTCTGTTTAGGTTTGTTTGTGTTGAAATG
TTTGGCCAAAAATATTAGCTGCAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan