ESTScan Details for Unigene SGN-U215132

Score 
702
Direction 
Forward
Predicted Peptide Sequence 
MAVXVLLVKAYMDETTNPISSFANKVIGSLPVFGLIARIVNEEGGVGGDFIDFAEFRRRVGNKCSINDSRAFYEFRDRRGKTGDPLYVLL
CCWLAAVGAGLLKSEEILEGVARLSLANDIEFEEQNFIAMMNEAREKRSKLGAPAPTIPMEFRAEKALEAIHVCCYGRDLIDEEDEKLLS
TMLNAVFPTVGRQKVEIIVKEKAKRMADGTEEIKYEPKQLSKEAVQMQMKDLEFLKQXQFESGGMKFIIIFKVNFGTGDYTNRKIIPQTF
GXRKSQPHVMNDKSSSHNVAN
Predicted Coding Sequence 
ATGGCGGTGXCGGTCTTGCTCGTCAAGGCTTATATGGATGAGACCACAAATCCAATTTCTAGTTTTGCTAATAAGGTCATCGGTTCACTG
CCTGTTTTTGGTCTCATAGCCAGAATTGTCAATGAGGAAGGTGGTGTTGGAGGCGATTTTATTGATTTTGCGGAGTTCAGGAGGCGAGTC
GGTAACAAGTGTTCCATTAATGATTCAAGAGCTTTTTATGAATTTCGAGATCGACGTGGCAAGACAGGGGATCCTCTGTATGTGCTACTG
TGTTGTTGGTTAGCTGCAGTAGGAGCTGGTTTACTCAAATCTGAGGAAATTTTGGAAGGGGTAGCAAGGCTTAGTTTAGCAAATGATATT
GAATTTGAAGAACAAAACTTCATCGCAATGATGAATGAAGCAAGGGAGAAGCGATCAAAGTTGGGAGCTCCAGCACCTACAATCCCCATG
GAATTTCGTGCTGAGAAAGCTCTTGAAGCTATACATGTGTGTTGCTATGGAAGGGATCTGATTGATGAAGAAGATGAAAAACTGCTAAGT
ACCATGCTTAATGCTGTCTTTCCTACAGTCGGGCGGCAAAAGGTAGAAATCATTGTCAAAGAGAAGGCAAAGAGAATGGCAGATGGAACT
GAAGAAATCAAATATGAGCCCAAGCAATTATCAAAAGAAGCAGTTCAGATGCAAATGAAAGACCTTGAATTTCTTAAGCAAAAXCAGTTT
GAATCAGGAGGCATGAAATTTATCATCATTTTTAAAGTAAATTTTGGTACTGGTGACTACACCAACAGGAAGATTATCCCACAAACATTC
GGTXATAGGAAATCACAGCCACATGTCATGAATGACAAATCTTCTTCGCACAATGTCGCCAACTAA\
Edits in Original Sequence 
GCACGAGCAAATATCAAAACAAAGATTGAACGTCCACCACATGTAACACTATGGTGGTTGTCTCCTCTCTCCACTCTCCTTCTTCTTCCT
CCTCCATCTACTGTAACTCAATCTCTCCCTCTCTTCGTTACTTTCGACGTTTCTATACATTTCCATCCAGAAGAAATAATTCCAACTCCA
(5')ATGGCGGTGXCGGTCTTGCTCGTCAAGGCTTATATGGATGAGACCACAAATCCAATTTCTAGTTTTGCTAATAAGGTCATCGGTTC
ACTGCCTGTTTTTGGTCTCATAGCCAGAATTGTCAATGAGGAAGGTGGTGTTGGAGGCGATTTTATTGATTTTGCGGAGTTCAGGAGGCG
AGTCGGTAACAAGTGTTCCATTAATGATTCAAGAGCTTTTTATGAATTTCGAGATCGACGTGGCAAGACAGGGGATCCTCTGTATGTGCT
ACTGTGTTGTTGGTTAGCTGCAGTAGGAGCTGGTTTACTCAAATCTGAGGAAATTTTGGAAGGGGTAGCAAGGCTTAGTTTAGCAAATGA
TATTGAATTTGAAGAACAAAACTTCATCGCAATGATGAATGAAGCAAGGGAGAAGCGATCAAAGTTGGGAGCTCCAGCACCTACAATCCC
CATGGAATTTCGTGCTGAGAAAGCTCTTGAAGCTATACATGTGTGTTGCTATGGAAGGGATCTGATTGATGAAGAAGATGAAAAACTGCT
AAGTACCATGCTTAATGCTGTCTTTCCTACAGTCGGGCGGCAAAAGGTAGAAATCATTGTCAAAGAGAAGGCAAAGAGAATGGCAGATGG
AACTGAAGAAATCAAATATGAGCCCAAGCAATTATCAAAAGAAGCAGTTCAGATGCAAATGAAAGACCTTGAATTTCTTAAGCAAAAXCA
GTTTGAATCAGtGAGGCATGAAATTTATCATCATTTTTAAAGTAAATTTTaGGTACTGGTGACTaACACCAACAGGAAGATTATCCCACA
AACATTCGGTXATAGGAAATCACAGCCACATGTCATGAATGACAAATCTTCTTCGCACAATGTCGCCAACTAA\(3')TTAAAAAACATT
GCATGTGTATGCTGCCTGCTCTCTTTCTTTTGTGATCAGTCTGCATTTTCTACTTGCACTTGAAAGATATAGTGGCTCTGATTTGTATTC
AAAAATTACCTATTACTATAACTGTAATGTTAATGACGACAGTCTCAAAACAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan