Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U215156

Score 
480
Direction 
Forward
Predicted Peptide Sequence 
MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITR
RETFNHLASWLEDARQHANANMTIMLIGNKCDLAHRRAVSTEEGEQFAKENGLIFMEASAKTAQNVEEAFIKTASTIYKKIQDGVFDVSN
ESYGIKVGY
Predicted Coding Sequence 
ATGTCGTACGCATATCTCTTCAAGTATATTATCATCGGCGATACTGGAGTTGGAAAGTCATGTCTACTTTTGCAATTTACGGACAAACGG
TTTCAACCAGTTCATGACCTGACCATCGGGGTTGAATTTGGGGCTCGAATGATCACAATCGACAACAAACCAATTAAACTACAGATCTGG
GACACGGCTGGTCAAGAATCATTCAGATCCATCACAAGGTCATATTACAGAGGGGCTGCGGGCGCATTACTTGTTTATGATATTACAAGG
AGGGAAACTTTTAATCACCTTGCTAGTTGGTTAGAAGATGCAAGACAGCATGCAAATGCAAACATGACCATAATGCTGATTGGGAACAAG
TGTGATCTGGCTCATAGAAGGGCTGTAAGCACAGAAGAAGGTGAGCAGTTTGCCAAAGAAAACGGATTGATATTCATGGAGGCCTCAGCT
AAAACAGCTCAGAATGTGGAAGAGGCTTTCATCAAAACAGCCTCAACAATCTATAAGAAAATACAGGATGGAGTGTTTGATGTATCGAAT
GAGTCCTATGGAATAAAAGTTGGATAT\
Edits in Original Sequence 
ACCTGCAAATTTTTTCAACTGTCTCTCTATATTCAGATCTCCGTTGATCCACCGCCGTATCGGTAAATC(5')ATGTCGTACGCATATCT
CTTCAAGTATATTATCATCGGCGATACTGGAGTTGGAAAGTCATGTCTACTTTTGCAATTTACGGACAAACGGTTTCAACCAGTTCATGA
CCTGACCATCGGGGTTGAATTTGGGGCTCGAATGATCACAATCGACAACAAACCAATTAAACTACAGATCTGGGACACGGCTGGTCAAGA
ATCATTCAGATCCATCACAAGGTCATATTACAGAGGGGCTGCGGGCGCATTACTTGTTTATGATATTACAAGGAGGGAAACTTTTAATCA
CCTTGCTAGTTGGTTAGAAGATGCAAGACAGCATGCAAATGCAAACATGACCATAATGCTGATTGGGAACAAGTGTGATCTGGCTCATAG
AAGGGCTGTAAGCACAGAAGAAGGTGAGCAGTTTGCCAAAGAAAACGGATTGATATTCATGGAGGCCTCAGCTAAAACAGCTCAGAATGT
GGAAGAGGCTTTCATCAAAACAGCCTCAACAATCTATAAGAAAATACAGGATGGAGTGTTTGATGTATCGAATGAGTCCTATGGAATAAA
AGTTGGATAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan