ESTScan Details for Unigene SGN-U215205

Score 
352
Direction 
Forward
Predicted Peptide Sequence 
METKVISSGINHSTLPQSYIRPESDRPRLSEVVDCENVPIIDLSCGDQAQIIRQIGEACQTYGFFQVINHGVPKEVVEKMLGVAGEFFNL
PVEEKLKLYSDDPSKTMRLSTSFNVKKETVHNWRDYLRLHCYPLEKYAPEWPSNPSSFR
Predicted Coding Sequence 
ATGGAAACCAAAGTTATTTCTAGCGGAATCAACCACTCTACTCTTCCTCAAAGTTACATCCGACCCGAATCCGATAGACCACGTCTATCG
GAAGTGGTCGATTGTGAAAATGTTCCAATAATTGACTTAAGTTGCGGAGATCAAGCTCAAATAATTCGTCAAATTGGAGAAGCTTGTCAA
ACTTATGGTTTCTTTCAGGTAATTAATCATGGTGTACCAAAGGAAGTTGTAGAGAAAATGCTAGGGGTAGCTGGGGAATTTTTCAATTTA
CCAGTAGAAGAGAAACTAAAATTATATTCAGATGATCCTTCAAAGACCATGAGATTATCAACAAGTTTTAATGTTAAAAAGGAGACAGTT
CATAATTGGAGAGATTATCTCAGACTTCATTGTTATCCTCTAGAGAAGTATGCTCCTGAATGGCCTTCTAATCCATCATCTTTCAGGTAA
\
Edits in Original Sequence 
TTCTTTCATTTGTAATTCAAAAATTATTACTCCTTCTTTACTTTTCCAATTTAATTATATTTATATGCAACTCCATATATATTATAAGCC
ATAGATTCC
(5')ATGGAAACCAAAGTTATTTCTAGCGGAATCAACCACTCTACTCTTCCTCAAAGTTACATCCGACCCGAATCCGATAG
ACCACGTCTATCGGAAGTGGTCGATTGTGAAAATGTTCCAATAATTGACTTAAGTTGCGGAGATCAAGCTCAAATAATTCGTCAAATTGG
AGAAGCTTGTCAAACTTATGGTTTCTTTCAGGTAATTAATCATGGTGTACCAAAGGAAGTTGTAGAGAAAATGCTAGGGGTAGCTGGGGA
ATTTTTCAATTTACCAGTAGAAGAGAAACTAAAATTATATTCAGATGATCCTTCAAAGACCATGAGATTATCAACAAGTTTTAATGTTAA
AAAGGAGACAGTTCATAATTGGAGAGATTATCTCAGACTTCATTGTTATCCTCTAGAGAAGTATGCTCCTGAATGGCCTTCTAATCCATC
ATCTTTCAGGTAA\(3')ACACCATTAATTAACTGTTTAACTACTTTCTTTATGTTAATATACATTGCTATCTGAGTCATACTTCAATTA
TTATTATCATTATATACGTCAACCACTTTGTCTGTATAGTAATGCATGGATTGGAAGTAACCTCAAATAATATATCGTATGAGATGTTGT
CAAGTATCTAAGTTATTTACGCGTATAAGAGAATACGAGGCTCAAACTGAGAAAGTGTGCATCCTTTAAAATAAGTGCATGTACATCACA
TATATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan