ESTScan Details for Unigene SGN-U215286

Score 
216
Direction 
Forward
Predicted Peptide Sequence 
MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLRLWDTAGQEDYNRLRPLSYRGADVFILAFSLISK
ASY
Predicted Coding Sequence 
ATGAGTGCTTCAAGGTTTATCAAATGTGTTACCGTCGGCGATGGTGCCGTTGGAAAGACGTGTCTCTTGATTTCTTACACCAGCAATACC
TTCCCCACGGATTATGTGCCCACCGTGTTCGACAATTTCAGTGCAAATGTGGTCGTCAATGGGAGCACTGTCAACCTAAGGTTGTGGGAT
ACTGCTGGACAGGAGGATTACAATAGGTTAAGACCTCTGAGTTACCGTGGAGCTGATGTTTTCATTTTGGCATTCTCTCTCATTAGTAAA
GCCAGCTATTAA\
Edits in Original Sequence 
ACCCATTTATTTTCATCCTTTCTCTCTCTACCTCAAACTTTCTCTTTCTAGATCTGGGATCCCTAAATTTCTCCTCATTTTCTCTTTACC
ATTTCTCTATTCTCATTTTCATTCACCTTATTCCCTTTCCCCTCTTCTACAATTCTCTCTGAACTTTCCCTTTCGTAGAATTAGGGTTAG
GGTTTCACCAAGAGAACCAAAGAAAACACCATTGGCATGTCTCGATTTTCTTCTCTGCTGGGTTTTCAAGCCATTCTGAAGAAACGACAT
TGAAAGGAATTGGAGAGGTTAAAAGAAACGGAAACAAGAAGCTCCAAGATACCACATTTAATCTCTTTTTTTCTTTTTAAATTTTTTCTG
GGATCAGGTCTTCTAAAGAAGATCTGAAAAGAGGAGGGTTATTGTTGGTTTTCTGAATAGCCGGGAAAA
(5')ATGAGTGCTTCAAGGTT
TATCAAATGTGTTACCGTCGGCGATGGTGCCGTTGGAAAGACGTGTCTCTTGATTTCTTACACCAGCAATACCTTCCCCACGGATTATGT
GCCCACCGTGTTCGACAATTTCAGTGCAAATGTGGTCGTCAATGGGAGCACTGTCAACCTAAGGTTGTGGGATACTGCTGGACAGGAGGA
TTACAATAGGTTAAGACCTCTGAGTTACCGTGGAGCTGATGTTTTCATTTTGGCATTCTCTCTCATTAGTAAAGCCAGCTATTAA\(3')
AACGTTGCCCAGAAGTGGATTCCTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan