ESTScan Details for Unigene SGN-U215308

Score 
438
Direction 
Forward
Predicted Peptide Sequence 
PSNFIAQKAKEVNFLSQNNNSIRVSMKGHNPIEVGKTVLEVADVAWSAVERCHHHTHSHTDTTAFDVSHSCEEDGLRSLRSENKRLKRLL
EQNLMLLQSMSQSPSLLQNCPPDLHERLLAAVESGSFLKQLEALNRKSVDGNDCQFPFKEATDVDTETAELLVNMSLEEPSWWVWVTEDM
VPGNLEERSGIDNDNYVIVSEEYVVDAVANFMADAXVSNSKAQKMSPEELQKTLAKAFEGIGKVETLFNIWHAAQMFYVLSLGDLQLWGE
HSFIISLFRXVSNLRRHNNTSVAVPNKFGIGKVETLFNIWHAAQMFYVLSTWGLAVVGLYKSRSVIRLAAKGVHKTGKMVLKVL
Predicted Coding Sequence 
XXTCCATCCAATTTTATTGCTCAGAAAGCAAAAGAAGTCAACTTTCTTTCGCAAAATAATAATTCAATTAGGGTTTCTATGAAGGGACAC
AATCCAATTGAGGTGGGGAAGACGGTGTTGGAGGTGGCCGATGTAGCATGGTCGGCGGTGGAACGCTGTCATCACCATACCCACAGTCAT
ACTGATACGACGGCGTTTGATGTATCTCATAGTTGTGAAGAAGATGGATTGAGATCTTTGAGGTCTGAAAACAAACGGCTCAAACGGTTG
CTTGAACAAAATCTTATGCTTCTTCAGAGCATGTCACAATCTCCTTCCTTACTTCAAAATTGTCCACCTGATCTTCATGAACGTCTCTTA
GCCGCTGTGGAATCCGGAAGCTTTTTGAAACAGCTGGAAGCACTGAATCGGAAATCTGTTGATGGGAATGACTGTCAATTTCCTTTCAAG
GAGGCAACTGATGTTGACACGGAGACAGCAGAACTTCTGGTGAACATGAGTCTTGAAGAACCAAGTTGGTGGGTTTGGGTGACTGAGGAT
ATGGTCCCTGGCAATCTTGAAGAAAGAAGCGGAATAGATAATGATAACTATGTGATTGTTAGTGAGGAATATGTTGTAGATGCAGTTGCC
AACTTTATGGCTGATGCGXTAGTATCCAATTCGAAGGCTCAGAAGATGTCTCCTGAAGAACTGCAAAAGACCCTGGCAAAAGCATTCGAA
GGCATTGGTAAAGTAGAAACATTGTTCAACATTTGGCATGCCGCGCAAATGTTCTACGTCCTTTCACTTGGGGACTTGCAGTTGTGGGGT
GAGCACTCATTTATTATTTCTTTATTTCGTGXTGTTTCCAATCTTAGAAGACATAACAATACCTCAGTAGCCGTCCCGAATAAGTTTGGC
ATTGGTAAAGTAGAAACATTGTTCAACATTTGGCATGCCGCGCAAATGTTCTACGTCCTTTCCACTTGGGGACTTGCAGTTGTGGGGTTG
TACAAGAGCCGATCTGTTATTAGACTTGCTGCTAAAGGGGTTCACAAGACAGGCAAAATGGTTCTGAAGGTTCTTTGA\
Edits in Original Sequence 
(5')XXTCCATCCAATTTTATTGCTCAGAAAGCAAAAGAAGTCAACTTTCTTTCGCAAAATAATAATTCAAtTTAGGGTTTCTATGAAGG
GACACAATCCAATTGAGGTGGGGAAGACGGTGTTGGAGGTGGCCGATGTAGCATGGTCGGCGGTGGAACGCTGTCATCACCATACCCACA
GTCATACTGATACGACGGCGTTTGATGTATCTCATAGTTGTGAAGAAGATGGATTGAGATCTTTGAGGTCTGAAAACAAACGGCTCAAAC
GGTTGCTTGAACAAAATCTTATGCTTCTTCAGAGCATGTCACAATCTCCTTCCTTACTTCAAAATTGTCCACCTGATCTTCATGAACGTC
TCTTAGCCGCTGTGGAATCCGGAAGCTTTTTGAAACAGCTGGAAGCACTGAATCGGAAATCTGTTGATGGGAATGACTGTCAATTTCCTT
TCAAGGAGGCAACTGATGTTGACACGGAGACAGCAGAACTTCTGGTGAACATGAGTCTTGAAGAACCAAGTTGGTGGGTTTGGGTGACTG
AGGATATGGTCCCTGGCAATCTTGAAGAAAGAAGCGGAATAGATAATGATAACTATGTGATTGTTAGTGAGGAATATGTTGTAGATGCAG
TTGCCAACTTTATGGCTaGATGCGXTAGTATCCAATTCGAAGGCTCAGAAGATGTCTCCTGAAGAACTGCAAAAGACCCTGGCAAAAGCA
TTCGAAGGCATTGGTAAAGTAGAAACATTGTTCAACATTTGGCATGCCGCGCAAATGTTCTACGTCCTTTCgACTTGGGGACTTGCAGTT
GTGGGGTGAGCACTCATTTATTATTTCTTTATTTCGTGXTGTTTCCAATCTTAGAAGACATAACAATACCTCAGTAGtCCGTCCCGAATA
AGTTTGGCATTGGTAAAGTAGAAACATTGTTCAACATTTGGCATGCCGCGCAAATGTTCTACGTCCTTTCCACTTGGGGACTTGCAGTTG
TGGGGTTGTACAAGAGCCGATCTGTTATTAGACTTGCTGCTAAAGGGGTTCACAAGACAGGCAAAATGGTTCTGAAGGTTCTTTGA\(3')
AGATGCCTCTGCTGTGTTGGTTATGAATTAAGCATCGTGTAAATGTTTTTACTTATTGTACAGTCTAGTATATCAGAATAACATTATGC
TTGACTTCCAATTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan