ESTScan Details for Unigene SGN-U215342

Score 
734
Direction 
Forward
Predicted Peptide Sequence 
TNYPHHKSPAPFNFQLHEEYXPVSTASNSSGSRAAPIFVQIFFIYLALTPSRTTVKPAAKETEKMPGIKGPSDYSREPPRHPSLKINAKE
PFNAEPTRSALISSYVTPVDFFYKRNHGPIPVVDDIERYSVSLSGLIKNSKDLFMKDICKLPKHTVTATLQCAGNRRTAMSKSRTVKGVG
WDIAALGNAVWGGAKLADVLELVGIPYLASITQSGGKHVEFVSIDKCKEENGGPYKASIPLSQATNPEADVLLAYEMNGEPLNRDHGYPL
RVVVPGVIGARSVKWLDSINIIAEECKGFFMQKDYKMFPPTVNWDNINWSTRRPQMDFPVQSAICSLEDVSVVKHGKINIKGYALSGGGR
GIERVDVSIDGGKTWEEATRYQRTGVPYIADDSSSDRWAWVFFEAEANIPQSAEIVAKAVDISANVQPESIDSVWNLRGILNTSWHRVHV
RVGQANLXGCVWCVEADDSNQHIRPWLFVSFLLKMKIAGGLRLPSLK
Predicted Coding Sequence 
XXGACAAATTATCCACATCACAAGTCACCAGCACCGTTTAATTTCCAATTGCATGAAGAGTATAAXCCTGTCTCCACAGCCTCAAATTCG
TCAGGTAGTAGGGCCGCTCCAATATTTGTACAAATCTTCTTCATCTACCTCGCACTCACACCTAGCAGGACTACTGTGAAGCCGGCGGCA
AAGGAAACTGAGAAAATGCCTGGGATTAAAGGGCCTTCCGATTATTCGCGAGAACCCCCTCGCCATCCTTCTCTTAAAATTAATGCCAAG
GAACCCTTTAATGCTGAGCCAACTCGTTCAGCTCTGATTTCATCTTATGTCACTCCTGTTGATTTCTTTTACAAGAGAAACCACGGACCC
ATACCAGTAGTGGATGACATAGAGAGGTATTCCGTTTCTCTGAGTGGTCTTATAAAAAATTCCAAAGACTTGTTTATGAAGGATATTTGT
AAGCTTCCAAAACATACGGTTACTGCCACTTTACAGTGTGCTGGTAACAGAAGAACTGCTATGAGTAAGAGTCGAACAGTGAAAGGAGTT
GGTTGGGATATTGCTGCTTTAGGAAATGCTGTTTGGGGTGGAGCCAAATTGGCAGATGTTCTAGAATTAGTTGGAATACCTTATTTGGCA
AGTATCACACAATCTGGAGGAAAACATGTGGAATTTGTGAGCATTGACAAGTGTAAGGAGGAAAATGGAGGTCCTTATAAGGCATCAATT
CCATTGAGTCAGGCTACAAACCCTGAAGCTGATGTTCTGCTCGCTTATGAGATGAATGGAGAGCCACTTAATAGGGATCATGGCTATCCA
CTGCGTGTGGTTGTCCCTGGTGTGATAGGTGCCCGTTCAGTTAAGTGGCTTGATTCCATCAATATCATTGCCGAAGAATGCAAGGGATTC
TTTATGCAAAAAGACTACAAGATGTTTCCACCAACAGTGAATTGGGATAACATCAACTGGTCTACTAGGAGACCGCAGATGGACTTTCCT
GTTCAGAGCGCAATATGTTCCCTGGAGGATGTGAGTGTTGTAAAGCATGGAAAGATAAACATCAAGGGGTACGCATTATCAGGAGGTGGG
CGTGGCATAGAAAGGGTAGACGTGTCTATAGATGGTGGTAAAACTTGGGAGGAAGCCACCAGATACCAGAGAACTGGTGTTCCATATATT
GCTGATGATTCAAGCAGTGACAGATGGGCATGGGTCTTTTTTGAAGCTGAGGCAAATATTCCCCAGAGTGCGGAAATAGTTGCTAAAGCG
GTGGATATATCTGCAAATGTCCAACCTGAAAGTATAGATTCTGTCTGGAATCTGAGAGGAATCCTGAACACCTCATGGCATCGGGTTCAT
GTCCGAGTTGGTCAAGCAAATCTTXTAGGCTGTGTTTGGTGTGTTGAAGCGGATGACAGTAATCAGCATATCAGGCCATGGTTGTTTGTA
TCCTTCTTGCTTAAAATGAAAATAGCTGGTGGTTTGCGTCTTCCTAGCTTAAAATGA\
Edits in Original Sequence 
(5')XXGACAAATTATCCACATCACAAGTCACaCAGCACCGTTTAATTTCCAATTGCATGAAGAGTATAAXCCTGTCTCCACAGCCTCAA
ATTCGTCAGGTAGTAGGGCCGCTCCAATATTTGTACAAATCTTCTTCATCTACCTCGCACTCACACCTAGCAGGACTACTGTGAAGCCGG
CGGCAAAGGAAACTGAGAAAATGCCTGGGATTAAAGGGCCTTCCGATTATTCGCGAGAACCCCCTCGCCATCCTTCTCTTAAAATTAATG
CCAAGGAACCCTTTAATGCTGAGCCAACTCGTTCAGCTCTGATTTCATCTTATGTCACTCCTGTTGATTTCTTTTACAAGAGAAACCACG
GACCCATACCAGTAGTGGATGACATAGAGAGGTATTCCGTTTCTCTGAGTGGTCTTATAAAAAATTCCAAAGACTTGTTTATGAAGGATA
TTTGTAAGCTTCCAAAACATACGGTTACTGCCACTTTACAGTGTGCTGGTAACAGAAGAACTGCTATGAGTAAGAGTCGAACAGTGAAAG
GAGTTGGTTGGGATATTGCTGCTTTAGGAAATGCTGTTTGGGGTGGAGCCAAATTGGCAGATGTTCTAGAATTAGTTGGAATACCTTATT
TGGCAAGTATCACACAATCTGGAGGAAAACATGTGGAATTTGTGAGCATTGACAAGTGTAAGGAGGAAAATGGAGGTCCTTATAAGGCAT
CAATTCCATTGAGTCAGGCTACAAACCCTGAAGCTGATGTTCTGCTCGCTTATGAGATGAATGGAGAGCCACTTAATAGGGATCATGGCT
ATCCACTGCGTGTGGTTGTCCCTGGTGTGATAGGTGCCCGTTCAGTTAAGTGGCTTGATTCCATCAATATCATTGCCGAAGAATGCAAGG
GATTCTTTATGCAAAAAGACTACAAGATGTTTCCACCAACAGTGAATTGGGATAACATCAACTGGTCTACTAGGAGACCGCAGATGGACT
TTCCTGTTCAGAGCGCAATATGTTCCCTGGAGGATGTGAGTGTTGTAAAGCATGGAAAGATAAACATCAAGGGGTACGCATTATCAGGAG
GTGGGCGTGGCATAGAAAGGGTAGACGTGTCTATAGATGGTGGTAAAACTTGGGAGGAAGCCACCAGATACCAGAGAACTGGTGTTCCAT
ATATTGCTGATGATTCAAGCAGTGACAGATGGGCATGGGTCTTTTTTGAAGCTGAGGCAAATATTCCCCAGAGTGCGGAAATAGTTGCTA
AAGCGGTGGATATATCTGCAAATGTCCAACCTGAAAGTATAGATTCTGTCTGGAATCTGAGAGGAATCCTGAACACCTCATGGCATCGGG
TTCATGTCCGAGTTGGTCAAGCAAATCTTXTAGGCTGTGTTTGGTGTGTTGAAGCGGATGACAGTAATCAGCATATCAGGCCATGGTTGT
TTGTATCCTTCTTaGCTTAAAATGAAAATAGCaTGGTGGTTTGCGTCTTCCTAGCTTAAAATGA\(3')AAATAAAATGTTCTCTTGATG
TTGTCTCGAAATACTTACGGAAATAATAATAATTTGGAAGTGATTGCATCTTGACAAAAAAAAAAAAGTTAGTTTCTTCTCCAGTTTCAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGGGGGGGGGAGAGAACTAGTCTCGAGGGGGGGCCCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan