ESTScan Details for Unigene SGN-U215359

Score 
1177
Direction 
Forward
Predicted Peptide Sequence 
MTTSNTQQSYDKTSELKAFDDTKAGVKGLIDSGITKVPQIFIHPEALENKTTNPKNTHFIFPLIDLQNISINNKEIVKQIQEASETWGFF
QVINHGIPVPVLDEMLRGARRFHDQDIDVKKPYYSRDIARKVMYNCNFDLFSEKSLAANWRDSLYSVMAPNPATPEEIPETCREITIEYS
NYVMNLGYTLLELFSEGLGLKPNHLKEMGCAEGLGILCNYYPKCPQPEIAIGTSRHADNDFFTVLLQDDIGGLQVLHKNQWVDVPPTHGA
LVVNIGDILQLISNDKYKSVVHRVLANTIGPRISIASFFSTGPFSTSRIYGPIEELLSKDNPPKYRSTTMKDFFEYSNKKGLDGNSNLSH
YKII
Predicted Coding Sequence 
ATGACAACCTCCAACACACAACAAAGCTATGACAAAACAAGTGAACTAAAAGCCTTTGATGACACAAAAGCAGGTGTCAAAGGACTTATT
GATAGTGGAATTACTAAAGTACCTCAAATATTCATTCATCCAGAGGCCTTAGAAAATAAAACCACAAATCCCAAAAATACACATTTCATT
TTCCCTTTAATAGACCTCCAAAACATCAGCATTAACAACAAAGAGATAGTGAAACAAATTCAAGAAGCATCAGAGACATGGGGTTTCTTT
CAAGTTATCAATCATGGTATCCCCGTCCCCGTCCTAGACGAAATGTTGCGTGGGGCACGACGTTTTCACGATCAAGATATCGACGTTAAA
AAGCCATACTATAGTCGAGATATTGCAAGGAAAGTTATGTACAATTGCAATTTTGATCTATTTAGTGAGAAATCTCTTGCAGCAAATTGG
AGAGACTCACTTTACTCTGTCATGGCTCCTAATCCTGCTACTCCCGAGGAAATCCCCGAGACATGCAGGGAAATCACAATTGAGTACTCA
AATTATGTGATGAATTTGGGATACACATTGCTTGAATTATTTTCAGAAGGACTTGGTTTAAAACCAAACCATCTCAAAGAAATGGGATGT
GCTGAGGGACTAGGCATTTTGTGCAATTACTACCCTAAATGTCCACAACCAGAAATTGCAATTGGCACAAGTAGACATGCTGATAATGAT
TTTTTCACAGTGCTTTTGCAAGATGATATTGGTGGACTTCAAGTTCTTCACAAGAATCAATGGGTTGATGTTCCTCCTACTCATGGAGCT
TTAGTTGTCAATATTGGTGACATTCTTCAGCTTATATCGAATGACAAATATAAGAGCGTAGTTCACAGAGTATTGGCAAATACAATTGGT
CCAAGAATATCAATAGCAAGTTTCTTCAGCACAGGGCCATTTTCAACTTCTAGAATTTATGGACCAATTGAGGAATTATTATCAAAAGAT
AATCCTCCAAAGTATAGATCAACAACAATGAAGGACTTCTTTGAATATTCTAATAAAAAAGGACTTGATGGCAATTCTAATTTGTCTCAC
TACAAAATAATATGA\
Edits in Original Sequence 
CCTCGTGCGGACGAGGCAAAAATTTGTGTTTCTTATCTTTTTATTACCTTTTTTAGACATCTTTAATTGAAGTACTTGTTTGTTCTCTCT
TAAGGATCGGTTCGAAAGTTTAAGTTTGAGTTCTCTGTGATCTCAATCAACAGATTTATTTGTTTTTGCTCTTCTAAAAAGCAGATTTCA
ATACTG
(5')ATGACAACCTCCAACACACAACAAAGCTATGACAAAACAAGTGAACTAAAAGCCTTTGATGACACAAAAGCAGGTGTCAA
AGGACTTATTGATAGTGGAATTACTAAAGTACCTCAAATATTCATTCATCCAGAGGCCTTAGAAAATAAAACCACAAATCCCAAAAATAC
ACATTTCATTTTCCCTTTAATAGACCTCCAAAACATCAGCATTAACAACAAAGAGATAGTGAAACAAATTCAAGAAGCATCAGAGACATG
GGGTTTCTTTCAAGTTATCAATCATGGTATCCCCGTCCCCGTCCTAGACGAAATGTTGCGTGGGGCACGACGTTTTCACGATCAAGATAT
CGACGTTAAAAAGCCATACTATAGTCGAGATATTGCAAGGAAAGTTATGTACAATTGCAATTTTGATCTATTTAGTGAGAAATCTCTTGC
AGCAAATTGGAGAGACTCACTTTACTCTGTCATGGCTCCTAATCCTGCTACTCCCGAGGAAATCCCCGAGACATGCAGGGAAATCACAAT
TGAGTACTCAAATTATGTGATGAATTTGGGATACACATTGCTTGAATTATTTTCAGAAGGACTTGGTTTAAAACCAAACCATCTCAAAGA
AATGGGATGTGCTGAGGGACTAGGCATTTTGTGCAATTACTACCCTAAATGTCCACAACCAGAAATTGCAATTGGCACAAGTAGACATGC
TGATAATGATTTTTTCACAGTGCTTTTGCAAGATGATATTGGTGGACTTCAAGTTCTTCACAAGAATCAATGGGTTGATGTTCCTCCTAC
TCATGGAGCTTTAGTTGTCAATATTGGTGACATTCTTCAGCTTATATCGAATGACAAATATAAGAGCGTAGTTCACAGAGTATTGGCAAA
TACAATTGGTCCAAGAATATCAATAGCAAGTTTCTTCAGCACAGGGCCATTTTCAACTTCTAGAATTTATGGACCAATTGAGGAATTATT
ATCAAAAGATAATCCTCCAAAGTATAGATCAACAACAATGAAGGACTTCTTTGAATATTCTAATAAAAAAGGACTTGATGGCAATTCTAA
TTTGTCTCACTACAAAATAATATGA\(3')ATTTTGATATGTTGGAGTAAAAATAATGTTTTTTTTTGTTTAACCAAAAAAAAAAAAGAT
TATCTACCTTAAGAATAAAAAGATGTTGCATTTGTACTTTTGTATTTGTTTTTGTTTGATATAAGAAATAAGAATGTGAGATTATTTATT
AAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan