Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U215370

Score 
583
Direction 
Forward
Predicted Peptide Sequence 
MSVVSSLAKYKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVIVYD
VANRQSFLNTSKWIEEVRTERGSDVIIVLVGNKTDLVEKRQVSTEEGDAKSREFGVMYVETSAKAGFNIKPLFRKIAAALPGMETLSSTK
QEDMVDVNLKPTTNTSQSEQQGGGCAXLDLYFKRKSKTEEETCKDTVASSYFRVFRIANFLVYEXLQHGFFFMMYNTLLDFIKEVSD
Predicted Coding Sequence 
ATGTCGGTGGTATCGTCATTAGCAAAGTATAAGCTGGTGTTTTTGGGAGATCAATCTGTGGGCAAAACCAGTATAATTACTCGTTTTATG
TACGATAAATTTGACACCACTTATCAGGCTACGATTGGTATTGATTTTTTATCAAAGACAATGTACCTTGAAGATCGAACAGTTCGCCTG
CAGCTCTGGGATACTGCTGGTCAAGAAAGATTTAGAAGTCTTATTCCAAGCTACATTAGAGATTCTTCTGTTGCTGTAATTGTATATGAT
GTTGCCAACCGCCAATCATTTCTGAACACTTCAAAATGGATCGAAGAAGTACGCACTGAACGAGGCAGTGATGTCATTATTGTTCTTGTT
GGGAACAAAACTGATCTTGTTGAGAAAAGGCAAGTTTCCACAGAAGAGGGAGATGCTAAATCTCGTGAATTTGGAGTTATGTATGTAGAA
ACCAGTGCTAAAGCTGGATTCAATATCAAGCCTCTGTTCCGAAAGATTGCTGCAGCCTTACCGGGGATGGAAACACTTTCATCCACAAAA
CAGGAAGATATGGTTGACGTTAATTTGAAGCCTACAACAAATACATCCCAATCAGAGCAGCAAGGTGGAGGTTGTGCAXTGTTAGATTTG
TACTTTAAGAGGAAGAGTAAGACAGAAGAGGAAACATGCAAAGACACAGTTGCATCCAGTTATTTTAGGGTGTTCAGAATAGCGAATTTC
TTAGTTTATGAGGXTTTGCAACATGGATTTTTCTTCATGATGTACAACACTTTGTTAGACTTTATCAAGGAGGTATCTGATTAA\
Edits in Original Sequence 
GCGGTTAGTGGTATTATATATATAGAGAGAATTCGAAGAGAGGCAGAGAAGTGTTTTATCTTCCTTAATTTTCTCTTTCCACCCATTCAG
ATCTGAGAGAGAGAAATTGTATTTTGAAGAAGAAAGAAAAAGAAAGGGTAATTCAATAGAATTTTGGTTCCA
(5')ATGTCGGTGGTATC
GTCATTAGCAAAGTATAAGCTGGTGTTTTTGGGAGATCAATCTGTGGGCAAAACCAGTATAATTACTCGTTTTATGTACGATAAATTTGA
CACCACTTATCAGGCTACGATTGGTATTGATTTTTTATCAAAGACAATGTACCTTGAAGATCGAACAGTTCGCCTGCAGCTCTGGGATAC
TGCTGGTCAAGAAAGATTTAGAAGTCTTATTCCAAGCTACATTAGAGATTCTTCTGTTGCTGTAATTGTATATGATGTTGCCAACCGCCA
ATCATTTCTGAACACTTCAAAATGGATCGAAGAAGTACGCACTGAACGAGGCAGTGATGTCATTATTGTTCTTGTTGGGAACAAAACTGA
TCTTGTTGAGAAAAGGCAAGTTTCCACAGAAGAGGGAGATGCTAAATCTCGTGAATTTGGAGTTATGTATGTAGAAACCAGTGCTAAAGC
TGGATTCAATATCAAGCCTCTGTTCCGAAAGATTGCTGCAGCCTTACCGGGGATGGAAACACTTTCATCCACAAAACAGGAAGATATGGT
TGACGTTAATTTGAAGCCTACAACAAATACATCCCAATCAGAGCAGCAAGGTGGAGGTTGTGCAXTGTTAGATTTGTACTTTAAGAGGAA
GAGTAAGACAGAAGtAGGAAACATGCAAAGACACAGTTGCATCCAGTTATTTTAGGGTGTTCAGAATAGCGAATTTCTTAGTTTATGAGG
XTTTGCAACATGGATTTTTCTTCATGATGTACAACACTTTGTTAGACTTTATCAAGGAGGTATCTGATTAA\(3')AGGCTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan