Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U215406

Score 
860
Direction 
Forward
Predicted Peptide Sequence 
MAAPPARARADYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMG
ILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKILVGNKADMDESKRAVPTSKGQALADEYGIKFFETSAKTNLNVEEVFFSIGKDIKQR
LSESDSKTEPQSIRINQSDQAGTAGQGAQKSLAVVRKPELATVFLIALGVQIGGDEKLILVNFITIYLPLDGKFGXVKGLFYFIFGIYLS
YTA
Predicted Coding Sequence 
ATGGCAGCTCCACCAGCTAGGGCTCGAGCAGATTATGATTATCTCATCAAGCTTCTCCTCATTGGCGATAGCGGTGTGGGAAAGAGTTGT
TTACTTCTGAGATTCTCAGACGGATCCTTCACAACAAGTTTCATCACAACTATTGGAATTGATTTTAAGATAAGAACAATTGAACTTGAT
GGCAAGCGGATTAAGTTACAAATTTGGGATACAGCTGGTCAAGAGCGTTTCCGCACTATCACAACAGCGTATTACCGAGGAGCAATGGGG
ATTCTGCTGGTGTATGATGTCACGGACGAGTCTTCTTTCAATAACATCAGGAACTGGATTCGCAACATAGAGCAGCATGCTTCTGATAAT
GTCAACAAGATTTTGGTCGGGAACAAGGCTGATATGGATGAAAGCAAAAGGGCTGTGCCAACTTCCAAAGGTCAAGCTCTTGCTGATGAA
TATGGCATTAAGTTCTTTGAAACAAGTGCAAAGACAAACCTGAATGTCGAAGAAGTTTTCTTTTCAATTGGTAAGGATATCAAGCAAAGG
CTTTCAGAATCTGATTCCAAGACTGAGCCTCAGTCAATCAGGATCAACCAATCCGATCAGGCAGGAACTGCTGGTCAAGGTGCCCAGAAG
TCACTTGCTGTGGTTCGTAAGCCXGAGTTGGCTACTGTTTTCTTGATTGCACTTGGTGTACAAATTGGTGGGGATGAAAAACTGATCCTT
GTGAACTTCATTACCATTTATCTGCCATTGGATGGCAAGTTTGGTGXTGTCAAAGGCCTTTTCTACTTTATATTTGGAATCTATTTGTCA
TATACAGCTTAA\
Edits in Original Sequence 
TTTGGTAGATTTTTTTCTACCATCTCACAATTTTTCTTCCCCTTCAGCCCAATGTCGCCGGCGACTTTCTGACCTGCTCGATAACCTCCG
TCTCTCTCTCCGTTCGAAACAGATTTCTAGGGTTTTGGATTGTTGATTCAAATTTATACATATCGGAATAAGACG
(5')ATGGCAGCTCC
ACCAGCTAGGGCTCGAGCAGATTATGATTATCTCATCAAGCTTCTCCTCATTGGCGATAGCGGTGTGGGAAAGAGTTGTTTACTTCTGAG
ATTCTCAGACGGATCCTTCACAACAAGTTTCATCACAACTATTGGAATTGATTTTAAGATAAGAACAATTGAACTTGATGGCAAGCGGAT
TAAGTTACAAATTTGGGATACAGCTGGTCAAGAGCGTTTCCGCACTATCACAACAGCGTATTACCGAGGAGCAATGGGGATTCTGCTGGT
GTATGATGTCACGGACGAGTCTTCTTTCAATAACATCAGGAACTGGATTCGCAACATAGAGCAGCATGCTTCTGATAATGTCAACAAGAT
TTTGGTCGGGAACAAGGCTGATATGGATGAAAGCAAAAGGGCTGTGCCAACTTCCAAAGGTCAAGCTCTTGCTGATGAATATGGCATTAA
GTTCTTTGAAACAAGTGCAAAGACAAACCTGAATGTCGAAGAAGTTTTCTTTTCAATTGGTAAGGATATCAAGCAAAGGCTTTCAGAATC
TGATTCCAAGACTGAGCCTCAGTCAATCAGGATCAACCAATCCGATCAGGCAGGAACTGCTGGTCAAGGTGCCCAGAAGTCAtCTTGCTG
TGGTTCGTAAGCCXGAGTTGGCTACTGTTTTCTTGATTGCACTTGGaTGTACAAATTGGTGGGGATGAAAAACTGATCCTTGTGAACTTC
ATTACCATTTATCTGCCATTGGATGGCAAGTTTGGTGXTGTCAAAGGCCTTTTCTACTTTATATTTGGAATCTATTTGTCATATACAGCT
TAA\(3')TAGCCTTTGTTTGGTTATTGTTCTTTGTTATCTATGTCTCTTAGGATTTCATCTCCTTTCCTTGTTTTAATCATGAAACTAT
TAGCTTTTGCTTTGATTTAGAAGGTGAAAGAAAAATATAATGCATGCATGAGTTATAACCTAATTTTTTTTTCTTCCTCAACAGACTCTC
AATTAAATCTTAGACTAATAATAGCTACGCTTCAGTCCCGAATAAGTTGTTTTGTCAATGTGAATAGTTTACTCATATTTTATTTAAGAT
CTAACTCATATTATCATCGCACTTAGCGCGTGATGATGGTAGTCCGCATTAGCTTGTGACTTTACACTAACTTGTCGATTTCATAATAAA
TTGAGACTAAAACGTTGCTGTCTAAGATAATTTCCAAAAAAAAAAAAAAAAAAACTCGAGGGGGGCCCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan