ESTScan Details for Unigene SGN-U215463

Score 
658
Direction 
Forward
Predicted Peptide Sequence 
MEEARSRKLGGSLKVPNVQELAKQQLAGVPSRYIRVNDDENQLYNSSILLPRELAPVIDMKKLLKIIKDDDTELNRFHLACKEWGFFQLV
NHGVSSSLMEKVKSEIRAFFDLPMEEKTKFEQEEGDIEGYGQAFVVSEEQKLDWGDMLYMITLPTHLRKPHLFPKLPASLRDALEQYSTA
LKELAMKILYVMARALGMRTEDMNVLFEQDGTQMMRINIILLVLTRARNGVMPHTDAIGL
Predicted Coding Sequence 
ATGGAAGAAGCGAGGTCGAGAAAGCTAGGTGGCTCTTTGAAAGTTCCTAACGTTCAGGAGCTGGCAAAACAACAACTAGCAGGTGTTCCA
TCGCGATATATTCGTGTTAATGATGACGAAAATCAATTGTATAATTCTTCCATATTATTGCCTCGTGAATTAGCTCCAGTTATTGACATG
AAAAAACTGCTCAAAATAATTAAAGACGATGATACAGAGCTTAACAGGTTTCATCTTGCTTGCAAAGAATGGGGATTTTTCCAGTTGGTG
AATCACGGAGTGAGTTCATCATTGATGGAGAAAGTGAAGTCAGAAATCAGAGCATTTTTCGATCTACCAATGGAAGAGAAGACGAAATTC
GAGCAAGAGGAAGGAGATATCGAAGGATACGGACAAGCATTTGTTGTATCTGAAGAACAAAAGTTAGACTGGGGTGACATGCTTTACATG
ATCACTCTTCCTACTCATTTGCGAAAACCTCACTTGTTTCCGAAGCTTCCTGCCTCACTCAGGGATGCATTGGAACAATACTCAACAGCA
CTGAAGGAACTTGCTATGAAAATTCTGTACGTAATGGCAAGAGCTTTAGGGATGAGAACAGAGGATATGAATGTATTATTTGAACAAGAC
GGGACACAAATGATGAGAATAAATATTATCCTCCTTGTCCTCACCAGAGCGCGTAATGGGGTTATGCCTCATACGGATGCTATTGGTCTA
\
Edits in Original Sequence 
GCAAAGTAAAATAAAATTTTATCGACCACACACAATAATCTTTCAATCCTAGATAACGATTTTGCTAGAAAAAAAAAATACATGTTGATG
(5')ATGGAAGAAGCGAGGTCGAGAAAGCTAGGTGGCTCTTTGAAAGTTCCTAACGTTCAGGAGCTGGCAAAACAACAACTAGCAGGTGT
TCCATCGCGATATATTCGTGTTAATGATGACGAAAATCAATTGTATAATTCTTCCATATTATTGCCTCGTGAATTAGCTCCAGTTATTGA
CATGAAAAAACTGCTCAAAATAATTAAAGACGATGATACAGAGCTTAACAGGTTTCATCTTGCTTGCAAAGAATGGGGATTTTTCCAGTT
GGTGAATCACGGAGTGAGTTCATCATTGATGGAGAAAGTGAAGTCAGAAATCAGAGCATTTTTCGATCTACCAATGGAAGAGAAGACGAA
ATTCGAGCAAGAGGAAGGAGATATCGAAGGATACGGACAAGCATTTGTTGTATCTGAAGAACAAAAGTTAGACTGGGGTGACATGCTTTA
CATGATCACTCTTCCTACTCATTTGCGAAAACCTCACTTGTTTCCGAAGCTTCCTGCCTCACTCAGGGATGCATTGGAACAATACTCAAC
AGCACTGAAGGAACTTGCTATGAAAATTCTGTACGTAATGGCAAGAGCTTTAGGGATGAGAACAGAGGATATGAATGTATTATTTGAACA
AGACGGGACACAAATGATGAGAATAAATATTATCCTCCTTGTCCTCACCAGAGCGCGTAATGGGGTTATGCCTCATACGGATGCTATTGG
TCTA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan