ESTScan Details for Unigene SGN-U215514

Score 
269
Direction 
Forward
Predicted Peptide Sequence 
MDKKXVKLGRKITNILSINLGLNENYLHTKFGGDNERGACLRVNFYPRCPQPDLTLGLSSHSDPGGMTLLLPDTDVPGLQVRRGDDWITV
KPIPNAFIVNIGDQIQVLSNAIYKSIEHRVIVNSGQERVSLAFFYNPGGDILIQPAEELVTEDQPALYLPTTFNEYRAFIRTNGPRGKSQ
VESLKSPR
Predicted Coding Sequence 
ATGGACAAGAAGXTAGTAAAATTAGGTCGAAAAATAACAAATATCTTGTCGATTAACCTTGGATTAAATGAAAATTATCTACACACAAAA
TTTGGTGGAGACAATGAAAGAGGTGCATGTTTAAGGGTTAACTTTTACCCTAGATGTCCCCAACCTGACCTAACACTTGGACTCTCTTCC
CACTCTGATCCTGGTGGCATGACCCTTCTCCTCCCCGACACCGACGTCCCCGGCCTCCAAGTCCGTCGTGGTGATGACTGGATAACGGTT
AAACCGATTCCTAATGCCTTTATCGTTAATATTGGAGATCAAATTCAGGTACTAAGCAATGCAATATACAAAAGCATAGAGCATCGCGTG
ATCGTTAATTCAGGGCAAGAACGTGTCTCTTTAGCATTTTTCTACAATCCAGGAGGTGACATCCTTATTCAACCTGCTGAAGAACTTGTG
ACGGAGGATCAGCCGGCGTTATATTTACCGACGACGTTCAACGAGTATCGAGCTTTCATTAGAACAAACGGACCTAGAGGAAAATCTCAA
GTTGAATCACTAAAATCGCCGAGATAA\
Edits in Original Sequence 
TTTTAAACTATGATATATAAATTATTATTAAAAACAAAAAAAAAAATTTTTTTTAAGCTGATTAAAAAGAAAAAGGTGTTAAATAAATTG
AATAAATGGAATACCTCTTGAAATAAGTTGATTTTGATAGTTTCGCCTCAAAGAGGCCTAGTGGATGATGCACTAGTTGATAATTAACGG
TGTAAAAAAGTATATTTACATAATTAAATCAGTAAATTTCTTAATAAATAAATATCGATGGATCGGGTCCTATGTGGGGGTGTTTGGGAC
CATGGTCCTGACCACCTTGGCTGGTTGGTAAATGCAAGTTGCTGTCTTAGTACTAGTATGCTTATTTAAAAAGTACATAATCCTTCTGAA
AAAACATGTCAAACGTGAAAATAATTTAATATTTGTACATTTTTTCCATCTAACTGACTTTTGTCTTTTTCTTTCTTTTTGTAATTTGTA
AGGAAAATAATTGGTGAAT
(5')ATGGACAAGAAGXTAGTAAAATTAGGTCGAAAAATAACAAATATCTTGTCGATTAACCTTGGATTAA
ATGAAAATTATCTACACACAAAATTTGGTGGAGACAATGAAAGAGGTGCATGTTTAAGGGTTAACTTTTACCCTAGATGTCCCCAACCTG
ACCTAACACTTGGACTCTCTTCCCACTCTGATCCTGGTGGCATGACCCTTCTCCTCCCCGACACCGACGTCCCCGGCCTCCAAGTCCGTC
GTGGTGATGACTGGATAACGGTTAAACCGATTCCTAATGCCTTTATCGTTAATATTGGAGATCAAATTCAGGTACTAAGCAATGCAATAT
ACAAAAGCATAGAGCATCGCGTGATCGTTAATTCAGGGCAAGAACGTGTCTCTTTAGCATTTTTCTACAATCCAGGAGGTGACATCCTTA
TTCAACCTGCTGAAGAACTTGTGACGGAGGATCAGCCGGCGTTATATTTACCGACGACGTTCAACGAGTATCGAGCTTTCATTAGAACAA
ACGGACCTAGAGGAAAATCTCAAGTTGAATCACTAAAATCGCCGAGATAA\(3')ATGTCCTTTAGCATGACCCCGACACGCACAAAACG
AGAAATAATCCAATTATAAAGATAATTAAATTACCTTTATATGTTCTATATAGTAAGTATATGGTACTTAAGGAAGTTTTACTGCGTATA
AATTCCAATTGGTAAAACATAACACAGTAAATACCCTATGTCCCTATATGATGTACTAGTACAATATGTGTTGTCATTTTCCTATGTTAT
TTTCAAATGTTTTGTCAAATTCACTTTGCTTTGTGAAATATTGTATTCATCCCTTCAATAGATATATGGTTCATCTAATTAAAAAAAAAA
AA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan