ESTScan Details for Unigene SGN-U215618

Score 
638
Direction 
Forward
Predicted Peptide Sequence 
APSRIQSLHPSSSMTLLKPLHHHLRRRLSISAAAAVRQDTNLWTTAPLVTVSPAAESLFHVTIDVSDYPDLANSHTKAGQYLQLRIPDVE
KPSFLAIASPPSLAAAKGVFEFLVKSISGSTAELLCGLQKGDVVELSQVMGKGFDLDQISPAEEYQTVVIFATGSGISPIRSLIEAGFGA
DRRSDVRVYYGARNLKRMAYQDRFENWASSGVKVVPVLSQPDDAWKGEDGYVQAAFARAKNIFNPQSTGAVLCGQKQMAEEVTSLLVADG
VSTEKILKNF
Predicted Coding Sequence 
GCTCCCTCCCGTATCCAATCACTCCATCCTTCTTCATCCATGACCCTCCTCAAACCTCTCCACCACCATCTCCGTCGCCGTCTCTCCATC
TCCGCCGCCGCAGCCGTCCGTCAAGACACTAATCTCTGGACAACCGCGCCTCTCGTCACTGTTTCACCTGCCGCGGAATCTCTCTTCCAC
GTCACCATCGACGTGTCCGATTACCCAGACCTAGCTAACTCACACACCAAGGCAGGTCAATATCTTCAGCTTCGGATTCCTGACGTGGAG
AAACCGTCGTTTTTAGCGATTGCATCTCCGCCTTCGCTTGCTGCAGCGAAAGGTGTGTTTGAGTTCCTTGTGAAAAGTATTTCTGGCTCT
ACGGCGGAGCTACTATGTGGATTGCAGAAAGGGGATGTTGTGGAGTTGAGTCAGGTTATGGGGAAAGGATTTGACTTGGATCAAATCTCT
CCTGCGGAGGAGTATCAGACGGTCGTGATTTTTGCAACCGGATCTGGAATCAGCCCAATTAGATCCCTGATTGAGGCAGGGTTTGGTGCA
GACAGGAGATCTGATGTTCGGGTATATTATGGTGCACGGAATTTGAAGAGAATGGCATATCAGGATAGGTTTGAAAACTGGGCATCCTCT
GGGGTTAAGGTTGTGCCAGTGTTGTCTCAGCCTGATGATGCTTGGAAAGGTGAAGACGGCTATGTTCAGGCAGCATTTGCCCGAGCTAAA
AACATTTTTAATCCTCAATCCACCGGAGCAGTCCTCTGTGGTCAAAAGCAAATGGCTGAGGAGGTGACTTCTCTTCTTGTAGCAGATGGA
GTCTCAACCGAGAAGATTCTGAAGAACTTCTGA\
Edits in Original Sequence 
ACTCTTCTCGGCGGCGCTTTCTAGTTTCTATGATTCTTCCTTCTCACCATATAATTGGAAAAAAAAATGTCAATCCTTTCTCTCTCCTTT
TCTCCATTTCCAAATTCATCTCTCTCTCATCTCAGTTCCCAT
(5')GCTCCCTCCCGTATCCAATCACTCCATCCTTCTTCATCCATGAC
CCTCCTCAAACCTCTCCACCACCATCTCCGTCGCCGTCTCTCCATCTCCGCCGCCGCAGCCGTCCGTCAAGACACTAATCTCTGGACAAC
CGCGCCTCTCGTCACTGTTTCACCTGCCGCGGAATCTCTCTTCCACGTCACCATCGACGTGTCCGATTACCCAGACCTAGCTAACTCACA
CACCAAGGCAGGTCAATATCTTCAGCTTCGGATTCCTGACGTGGAGAAACCGTCGTTTTTAGCGATTGCATCTCCGCCTTCGCTTGCTGC
AGCGAAAGGTGTGTTTGAGTTCCTTGTGAAAAGTATTTCTGGCTCTACGGCGGAGCTACTATGTGGATTGCAGAAAGGGGATGTTGTGGA
GTTGAGTCAGGTTATGGGGAAAGGATTTGACTTGGATCAAATCTCTCCTGCGGAGGAGTATCAGACGGTCGTGATTTTTGCAACCGGATC
TGGAATCAGCCCAATTAGATCCCTGATTGAGGCAGGGTTTGGTGCAGACAGGAGATCTGATGTTCGGGTATATTATGGTGCACGGAATTT
GAAGAGAATGGCATATCAGGATAGGTTTGAAAACTGGGCATCCTCTGGGGTTAAGGTTGTGCCAGTGTTGTCTCAGCCTGATGATGCTTG
GAAAGGTGAAGACGGCTATGTTCAGGCAGCATTTGCCCGAGCTAAAAACATTTTTAATCCTCAATCCACCGGAGCAGTCCTCTGTGGTCA
AAAGCAAATGGCTGAGGAGGTGACTTCTCTTCTTGTAGCAGATGGAGTCTCAACCGAGAAGATTCTGAAGAACTTCTGA\(3')ACAATT
CCAATTTTGGTTCGTCGTGTTGTATTATTGTCTAGTATAAAATCAATTTATTCGATTTCACCTGCTGGCTTCAAGGTATTCAGCATGGTC
AAACAACATAATGTAACAATGTTAGCCATCAGCCATCAGGCTATACAAAGTCCAATGTGGCTCGTATATGCATTCAATCAAAATTAATTG
TTGAATAGTCAGTACTAAAGAAGGAAAACGCTATAATACCACTGTTCTTGTTTTTGTTTATTGAGTAGGGAGGCTCAAGGTGTTAATTTA
TGCTAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan