ESTScan Details for Unigene SGN-U215776

Score 
536
Direction 
Forward
Predicted Peptide Sequence 
MGLLSNRIDRSSLKPGDHIYSWRTAYIYAHHGIYVGDNKVIHFTRRGQEVGTGTILDHILVSSIPNRSTVPCTVCTPPSDGHGVVSSCLD
CFLAGGILYRFEYAVTPAIFLAKARGGTCTLAVSDPDDIVVHRANYLLTNGFGLYNVFKNNCEDFAIYSKTGLLVVDDSTMGQSGQAVSI
IGGPLAAVMSTPLRLVTTNVYGMVATAVGAIVPVAXAADIGMRRDVMKVSAEDLTTRLTTGLLRVVEPSLAVLPPTTS
Predicted Coding Sequence 
ATGGGGTTGCTTTCTAATAGAATTGATAGAAGCAGCCTCAAACCTGGAGATCATATTTATTCTTGGCGTACTGCTTATATTTATGCCCAT
CATGGTATCTATGTTGGGGATAATAAAGTCATTCACTTCACAAGACGTGGTCAAGAAGTAGGAACTGGAACCATTCTGGATCATATTTTG
GTAAGTTCAATTCCAAATCGATCTACTGTTCCTTGTACTGTTTGCACCCCACCATCAGATGGTCACGGAGTAGTCTCGTCATGTTTGGAC
TGCTTTCTTGCTGGAGGTATCCTCTATCGCTTTGAATATGCTGTAACTCCTGCTATCTTCCTCGCAAAAGCACGTGGAGGAACATGCACT
CTTGCAGTCTCGGATCCAGATGACATTGTAGTCCATCGAGCAAACTACCTCCTTACAAATGGCTTTGGACTGTACAATGTGTTCAAGAAC
AACTGTGAGGACTTCGCCATCTACTCTAAGACAGGACTACTCGTGGTAGATGATAGTACAATGGGACAAAGTGGACAAGCAGTGTCTATA
ATCGGTGGACCACTTGCAGCTGTTATGTCAACACCACTACGTCTAGTCACCACCAACGTTTATGGGATGGTAGCAACAGCTGTTGGGGCT
ATTGTGCCAGTCGCTXATGCAGCTGATATTGGTATGCGGAGGGATGTGATGAAAGTATCTGCAGAAGATCTAACAACAAGGCTAACAACT
GGCTTGCTCCGGGTTGTTGAACCTAGTCTCGCAGTTTTGCCACCTACGACTAGCTAG\
Edits in Original Sequence 
TCTTCTGTGTCTATCATTTACTTAATAAGCAAAAACTTTTGTTCTTGATCAAATTTTGATTCATCATATCCTTCTGTTTATCCAAAAAAA
TTAAGAA
(5')ATGGGGTTGCTTTCTAATAGAATTGATAGAAGCAGCCTCAAACCTGGAGATCATATTTATTCTTGGCGTACTGCTTATA
TTTATGCCCATCATGGTATCTATGTTGGGGATAATAAAGTCATTCACTTCACAAGACGTGGTCAAGAAGTAGGAACTGGAACCATTCTGG
ATCATATTTTGGTAAGTTCAATTCCAAATCGATCTACTGTTCCTTGTACTGTTTGCACCCCACCATCAGATGGTCACGGAGTAGTCTCGT
CATGTTTGGACTGCTTTCTTGCTGGAGGTATCCTCTATCGCTTTGAATATGCTGTAACTCCTGCTATCTTCCTCGCAAAAGCACGTGGAG
GAACATGCACTCTTGCAGTCTCGGATCCAGATGACATTGTAGTCCATCGAGCAAACTACCTCCTTACAAATGGCTTTGGACTGTACAATG
TGTTCAAGAACAACTGTGAGGACTTCGCCATCTACTCTAAGACAGGACTACTCGTGGTAGATGATAGTACAATGGGACAAAGTGGACAAG
CAGTGTCTATAATCGGTGGACCACTTGCAGCTGTTATGTCAACACCACTACGTCTAGTCACCACCAACGTTTATGGGATGGTAGCAACAG
CTGTTGGGGtCTATTGTGCCAGTCGCTXATGCAGCTGATATTGGTATGCGGAGGGATGTGATGAAAGTATCTGCAGAAGATCTAACAACA
AGGCTAACAACTGGCTTGCTCCGGGTTGTTGAACCTAGTCTCGCAGTTTTGCCACCTACGACTAGCTAG\(3')TATCATTTCTTGATAT
GTAATAACGCGCTATAGAGTCGGAAAGTGAGCTTTCTTTTTAATATACATGGGAGCTTCTAGCTATATGTCTTGAGGCTTCTGTATCTGT
TGTACTTTATTATGTGTTGTTTTGCCTCCAAAAGAAGTCGTAATGTGATTGCAGATTTGTGATGTTTAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan