ESTScan Details for Unigene SGN-U215883

Score 
880
Direction 
Forward
Predicted Peptide Sequence 
TVHANWFQHFPEKISIMNIFSQIFTFFFFLIVVFVTKSSCSAIINPSKVKQISWKPRAFVYEGFLTDEECNHLISLAKKELKRSAVADNE
SGESKLSEVRTSSGMFISKAKDPIVTGIEEKIATWTFLPKENGEDIQVLRYEEGQRYEPHYDYFTDKVNIVRGGHRLATVLMYLSDVEKG
GETVFPEAEVSTRRRSMAADDSLSECAKRGIAVKPRKGDALLFFSLHPNAVPDPMSLHGGCPVMEGEKWSATKWIHVDSFDKTVDSEGGH
CADHNENCERWAALGECTKNPEYMVGSTDLPEAVERAANLVXLVSST
Predicted Coding Sequence 
XXGACAGTTCACGCGAATTGGTTTCAACATTTTCCCGAGAAAATTTCAATTATGAATATCTTCTCGCAGATCTTCACTTTCTTCTTCTTC
TTGATCGTTGTGTTCGTTACAAAATCATCATGCTCAGCAATCATCAATCCCTCTAAAGTCAAGCAAATTTCATGGAAACCTAGAGCTTTT
GTGTATGAAGGTTTTCTTACGGACGAAGAATGTAATCATTTGATATCTCTTGCGAAAAAAGAGTTGAAGAGATCAGCTGTTGCAGATAAT
GAATCTGGGGAAAGTAAGCTTAGTGAGGTCAGGACTAGCTCCGGAATGTTCATTAGCAAAGCAAAGGATCCTATTGTCACAGGGATAGAG
GAGAAGATAGCGACTTGGACTTTTCTACCTAAAGAGAATGGAGAAGACATACAAGTTCTAAGATATGAGGAAGGACAGAGATATGAGCCA
CACTATGATTACTTCACCGACAAGGTTAATATTGTTCGTGGTGGACACCGTTTAGCCACTGTACTCATGTATCTCAGTGATGTAGAGAAA
GGTGGTGAAACTGTTTTCCCCGAAGCAGAGGTATCAACTCGGCGTAGGTCAATGGCAGCTGACGACAGTTTGTCCGAGTGTGCAAAGAGG
GGTATTGCTGTTAAACCACGAAAAGGAGATGCACTTCTTTTTTTCAGTCTCCATCCAAATGCTGTACCTGATCCTATGAGCCTCCACGGT
GGATGCCCTGTTATGGAGGGTGAGAAGTGGTCAGCAACCAAGTGGATTCATGTGGATTCATTTGACAAAACAGTGGATTCTGAAGGAGGA
CATTGTGCTGATCATAACGAGAATTGTGAGAGATGGGCTGCACTTGGGGAATGCACCAAGAACCCAGAATATATGGTTGGAAGTACAGAC
CTCCCAGAAGCTGTAGAAAGAGCTGCAAATCTTGTTAAXCTTGTTTCTTCCACTTGA\
Edits in Original Sequence 
(5')XXGACAGTTCACGCGAATTGGTTTCAACATTTTCCCGAGAAAATTTCAATTATGAATATCTTCTCGCAGATCTTCACTTTCTTCTT
CTTCTTGATCGTTGTGTTCGTTACAAAATCATCATGCTCAGCAATCATCAATCCCTCTAAAGTCAAGCAAATTTCATGGAAACCTAGAGC
TTTTGTGTATGAAGGTTTTCTTACGGACGAAGAATGTAATCATTTGATATCTCTTGCGAAAAAAGAGTTGAAGAGATCAGCTGTTGCAGA
TAATGAATCTGGGGAAAGTAAGCTTAGTGAGGTCAGGACTAGCTCCGGAATGTTCATTAGCAAAGCAAAGGATCCTATTGTCACAGGGAT
AGAGGAGAAGATAGCGACTTGGACTTTTCTACCTAAAGAGAATGGAGAAGACATACAAGTTCTAAGATATGAGGAAGGACAGAGATATGA
GCCACACTATGATTACTTCACCGACAAGGTTAATATTGTTCGTGGTGGACACCGTTTAGCCACTGTACTCATGTATCTCAGTGATGTAGA
GAAAGGTGGTGAAACTGTTTTCCCCGAAGCAGAGGTATCAACTCGGCGTAGGTCAATGGCAGCTGACGACAGTTTGTCCGAGTGTGCAAA
GAGGGGTATTGCTGTTAAACCACGAAAAGGAGATGCACTTCTTTTTTTCAGTCTCCATCCAAATGCTGTACCTGATCCTATGAGCCTCCA
CGGTGGATGCCCTGTTATGGAGGGTGAGAAGTGGTCAGCAACCAAGTGGATTCATGTGGATTCATTTGACAAAACAGTGGATTCTGAAGG
AGGACATTGTGCTGATCATAACGAGAATTGTGAGAGATGGGCTGCACTTGGGGAATGCACCAAGAACCCAGAATATATGGTTGGAAGTAC
AGACCTCCCAgGAAGCTGTAGAAAGAGCTGCAAATCTTGTTAAXCTTGTTTCTTCCACTTGA\(3')ATCAGTTCAAAAACACACTAGTT
CTTTCTCTTTTTCGTTTGTTTGTCTCGTGTTTTTTCAGATGATATCATCTGTCGGGTCGTGTTCTTGCTATTTTACTCAATTTTGCAAGT
AATCTTGTACTATTTTCTTTCTTCTTTGTGGGTGTATATGTAAAACATTACGAGACTCTAATTAGGTTTTGCAGTTACCATCTAATACAA
AAAAAAAAAAAGTTTATTTAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan