ESTScan Details for Unigene SGN-U215953

Score 
1051
Direction 
Forward
Predicted Peptide Sequence 
ISELKSNFTNNFGAHQIKAASINXKTLEGIYQDDPVCPFAGASRPDDATLNKPYDENKQQAQESKPKKESGEVATVSPKCPFGYDSTLKK
PCDDQNKQQDGQESKPKQDSGESATVSPKCPFGYDGQESKPKQDSGESATVSPKCPFGYDGQKSKPKQDSGESATMSPKCPFGYDSQAFK
LGPFSCMICQALLYEAADVCPVHMYSARHVSPALRTXPLCGADIEKIEADMNLQNVVDRFIEGHARIKRSNNEQEDIVEKKTVIYEDASL
ERGAFLVQQAMRAFRANNIDSAKSRFTMCADDIREQLQRMGNTSELCSQLGAVLGMLGDCSRATGDAVSAVAYFEESVNFLLKVPKDDVE
ITHTLSVSLXKIGDLKYYAGDLQTARSHYFRALDVRRNAIKQQSVPSQVVDVAISLAKVADIDRNLGDEDTAVEGFQEGIKLLQSLELKP
EEVSLEXTAAISARVPXTANLKRTKLNSAAXNEVLSYIVKDE
Predicted Coding Sequence 
ATATCGGAATTGAAATCTAATTTCACCAATAATTTTGGGGCACATCAAATCAAAGCTGCTTCGATTAACXGCAAAACCCTAGAGGGAATT
TATCAAGATGATCCAGTTTGCCCTTTTGCTGGAGCTTCCAGACCCGATGATGCAACTCTTAATAAACCATATGACGAAAATAAACAACAG
GCTCAAGAGAGCAAGCCTAAAAAAGAATCTGGAGAAGTTGCTACGGTGTCACCTAAATGCCCCTTTGGATATGATTCAACTCTTAAGAAA
CCTTGTGACGACCAAAATAAACAACAGGATGGCCAGGAGAGCAAGCCTAAACAAGACTCTGGAGAATCTGCAACTGTGTCACCTAAGTGC
CCCTTTGGATATGATGGCCAGGAGAGCAAGCCTAAACAAGACTCTGGAGAATCTGCAACCGTGTCACCTAAGTGCCCCTTCGGATATGAT
GGCCAGAAGAGCAAGCCTAAACAAGACTCTGGAGAATCTGCGACAATGTCACCTAAGTGCCCCTTTGGTTATGATTCTCAAGCATTTAAA
CTGGGTCCTTTTAGCTGCATGATATGTCAAGCACTTCTTTATGAAGCAGCAGATGTGTGCCCTGTTCACATGTATTCTGCAAGGCATGTC
TCTCCCGCTTTAAGGACTGXTCCATTGTGTGGTGCTGATATTGAAAAGATTGAGGCCGATATGAATCTTCAGAATGTTGTCGATCGCTTT
ATTGAAGGGCATGCAAGGATTAAGAGGTCTAATAATGAGCAAGAAGATATAGTGGAAAAGAAAACTGTTATATACGAGGATGCATCTTTG
GAGCGTGGAGCTTTCCTGGTTCAACAAGCCATGCGGGCTTTTCGTGCCAATAATATTGATAGTGCAAAATCAAGATTTACTATGTGTGCA
GATGACATCAGAGAACAGCTTCAGAGAATGGGGAATACATCAGAGTTGTGCTCACAGCTCGGAGCAGTTCTTGGTATGCTTGGTGACTGC
AGTCGAGCTACAGGAGATGCTGTATCTGCAGTCGCTTACTTTGAAGAGAGTGTCAATTTCCTTTTGAAAGTACCCAAAGATGATGTAGAG
ATCACACATACACTTTCTGTTTCACTAAAXAAAATTGGAGATCTTAAATACTATGCCGGTGATTTGCAAACTGCCAGATCTCATTATTTT
CGGGCGTTGGATGTTCGCCGCAATGCCATCAAGCAACAGTCTGTGCCATCTCAGGTAGTCGATGTAGCCATTTCCTTAGCCAAAGTTGCT
GATATCGATCGAAATCTCGGGGATGAGGATACTGCAGTTGAAGGATTTCAAGAAGGCATAAAGTTACTGCAATCCCTTGAACTAAAACCC
GAAGAAGTTAGCCTTGAAXCAACGGCGGCAATCAGTGCTCGAGTTCCTXCAACAGCCAACTTGAAAAGAACGAAACTTAACTCAGCTGCC
CXGAATGAAGTCCTTTCCTACATAGTTAAGGACGAATAA\
Edits in Original Sequence 
AAAATAAAAAAATTGAATATAATATATCCTGGTTTCCATTATTTGAAAAGGGGAAAAAATAATAAAGAAAAAGATTTATCTTTTGGTTGA
TCAGAAAAATTTTCACA
(5')ATATCGGAATTGAAATCTAATTTCACCAATAATTTTGGGGCACATCAAATCAAAGtCTGCTTCGATTAA
CXGCAAAACCCTAGAGGGAATTTATCAAGATGATcCCAGTTTGCCCTTTTGCTGGAGCTTCCAGACCCGATGATGCAACTCTTAATAAAC
CATATGACGAAAATAAACAACAGGCTCAAGAGAGCAAGCCTAAAAAAGAATCTGGAGAAGTTGCTACGGTGTCACCTAAATGCCCCTTTG
GATATGATTCAACTCTTAAGAAACCTTGTGACGACCAAAATAAACAACAGGATGGCCAGGAGAGCAAGCCTAAACAAGACTCTGGAGAAT
CTGCAACTGTGTCACCTAAGTGCCCCTTTGGATATGATGGCCAGGAGAGCAAGCCTAAACAAGACTCTGGAGAATCTGCAACCGTGTCAC
CTAAGTGCCCCTTCGGATATGATGGCCAGAAGAGCAAGCCTAAACAAGACTCTGGAGAATCTGCGACAATGTCACCTAAGTGCCCCTTTG
GTTATGATTCTCAAGCATTTAAACTGGGTCCTTTTAGCTGCATGATATGTCAAGCACTTCTTTATGAgAGCAGCAGATGTGTGCCCTGTT
CACATGTATTCTGCAAGGCATGTCTCTCCCGCTTTAAGGACTGXTCCATTGTGTGGTGCTGATATTGAAAAGATTGAGGCCGATATGAAT
CTTCAGAATGTTGTCGATCGCTTTATTGAAGGGCATGCAAGGATTAAGAGGTCTAATAATGAGCAAGAAGATATAGTGGAAAAGAAAACT
GTTATATACGAGGATGCATCTTTGGAGCGTGGAGCTTTCCTGGTTCAACAAGCCATGCGGGCTTTTCGTGCCAATAATATTGATAGTGCA
AAATCAAGATTTACTATGTGTGCAGATGACATCAGAGAACAGCTTCAGAGAATGGGGAATACATCAGAGTTGTGCTCACAGCTCGGAGCA
GTTCTTGGTATGCTTGGTGACTGCAGTCGAGCTACAGGAGATGCTGTATCTGCAGTCGCTTACTTTGAAGAGAGTGTCAATTTCCTTTTG
AAAGTACCCAAAGATGATGTAGAGATCACACATACACTTTCTGTTTCACTAAAXAAAATTGGAGATCTTAAATACTATGCCGGTGATTTG
CAAACTGCCAGATCTCATTATTTTCGGGCGTTGGATGTTCGCCGCAATGCCATCAAGCAACAGTCTGTGCCATCTCAGGTAGTCGATGTA
GCCATTTCCTTAGCCAAAGTTGCTGATATCGATCGAAATCTCGGGGATGAGGATACTGCAGTTGAAGGATTTCAAGAAGGCATAAAGTTA
CTGCAATCCCTTGAACTAAAACCCGAAGAAGTTAGCCTTGAAXCAACGGCGGCAATCAGTGCTCGAGTTCCTXCAACAGCCAACTTGAAA
AGAACGAAACTTAACTCAGCTGCCCXGAATGAAGTCCTTTCCTACATAGTTAAGGACGAATAA\(3')GAACAATGTGTGTTCTCTCATA
TAGTTTGGTGTAAACACTAGATGCTCGGTTCAGAGGCAACCTGAGATAAACTTCGATGTAATCGCCGTAGAATAAGTGAGATTTTTAATA
GTAATATGCCTGTGGCAAAGTCAATATAGTCCTATGTTCCAAAATCTCAGTATCTTGTGTATGTATCTTTACCACAAGTTGACAATATTA
TTAAGTTATTGGAGGTTTATGACAATGTTATAAAAGTATAATGTGTGCTTCTCAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan