Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U216016

Score 
1266
Direction 
Forward
Predicted Peptide Sequence 
VRICSKGLTFPPTNFYHGNAFFAAQKAGRPKGSAAKSKDEREKEPHSSGKMRGSASKKAAAVDEEYVQWKSLVAVLYDWFANHNLIWPSS
LAGGGAVVEEGKYKNRQRLYLSEQTDKSVPNTLIIANCDVVKPRVAAENHIANFNEEARSPFVKKYKTIIHPGEVNRIRELPQNKNIVAT
HTDGPEVLIWDIEAQPNKHAVYGAAASRPDLVLSGHQDNAEFALALSPMEPFVLSGGKDKTVVLWSIQDHISTLAADATKSAGSGGSIIK
SADNPSIGPRGIFHGHADTVEDVQFCPSSSQEFCSVGDDSCLILWDARVGNNPAVKVEKAHDADLHCVDWNPHNDNLIITGSADNSVRLF
DRRNLTSDGVGSPVHMFEHHTAAVLCVQWCPNRSSVFGSCAEDGLLNIWDYEKVGAAKDSDIESDEDEEESPPGLFFQHAGHRDKIVDFH
WNACDPWTIVSVSDDAETSGGGGTLQIWRMIDMLYRPKAEVLAEMQHFKDMWASVPLSAKADECYF
Predicted Coding Sequence 
GTCCGTATTTGCTCCAAGGGTTTAACTTTCCCCCCAACAAATTTCTACCATGGAAACGCCTTCTTCGCAGCCCAAAAGGCTGGCAGGCCA
AAGGGTTCTGCTGCCAAATCCAAAGACGAAAGAGAAAAGGAACCTCACAGTTCCGGCAAGATGAGAGGTAGTGCTAGCAAGAAAGCTGCT
GCTGTGGACGAGGAGTATGTTCAGTGGAAGTCACTCGTTGCTGTCCTCTATGACTGGTTCGCTAATCACAACCTCATTTGGCCTTCCTCT
CTTGCAGGTGGXGGTGCAGTAGTTGAGGAGGGTAAATATAAAAACCGCCAGCGACTCTACCTTTCTGAACAGACGGATAAGTCAGTGCCT
AATACTTTGATCATCGCCAATTGTGATGTGGTTAAGCCCAGGGTTGCAGCAGAAAATCATATTGCAAATTTCAATGAAGAGGCACGCTCG
CCATTTGTGAAGAAGTACAAAACCATAATACATCCGGGAGAGGTTAACAGAATCAGAGAACTCCCGCAGAACAAAAACATAGTGGCAACC
CATACTGATGGTCCTGAAGTTCTCATTTGGGACATTGAAGCTCAGCCTAACAAGCATGCTGTCTATGGTGCTGCTGCTTCGCGTCCAGAT
CTGGTATTAAGTGGACATCAGGACAATGCAGAATTTGCTCTGGCTCTGTCCCCCATGGAACCCTTTGTCCTCTCTGGAGGGAAGGACAAG
ACTGTTGTATTATGGAGCATTCAAGATCACATTTCAACATTGGCAGCAGATGCAACCAAGTCTGCTGGATCTGGTGGCTCTATAATTAAG
TCTGCTGATAATCCTTCTATTGGACCACGTGGTATCTTCCATGGCCATGCGGATACCGTTGAAGATGTTCAGTTTTGTCCTTCAAGTTCC
CAGGAATTCTGTAGTGTTGGTGATGATTCATGCCTCATATTGTGGGATGCTCGTGTTGGTAACAATCCTGCTGTAAAGGTTGAGAAAGCT
CATGATGCTGATCTTCATTGTGTCGATTGGAATCCTCACAATGACAATCTTATCATAACTGGGTCCGCTGATAATTCAGTACGCTTATTT
GACCGGCGAAATTTGACTTCAGATGGGGTTGGGTCACCAGTACATATGTTTGAACATCACACAGCTGCAGTTCTCTGTGTTCAGTGGTGT
CCGAATAGGTCTTCTGTGTTTGGGAGCTGTGCAGAGGATGGTCTCTTAAATATTTGGGACTATGAGAAGGTTGGCGCAGCAAAAGATTCT
GATATTGAATCTGATGAAGATGAAGAGGAGTCTCCTCCAGGCTTGTTTTTTCAGCATGCTGGCCACAGGGATAAGATTGTGGACTTTCAC
TGGAATGCTTGTGATCCATGGACTATTGTTAGTGTATCTGATGATGCAGAGACCTCTGGTGGAGGGGGCACATTACAGATATGGCGTATG
ATTGATATGTTGTACCGGCCGAAGGCTGAAGTTTTGGCTGAGATGCAACATTTCAAGGACATGTGGGCAAGTGTACCCCTAAGTGCAAAG
GCTGATGAGTGTTATTTTTGA\
Edits in Original Sequence 
ATTCAATTTTACTTTTTTTCTTGAAATTTCAGAAATTCAACTTGAATTTTCAGTTATCATAAATTACATTTTGATATTCAACTTCAATTT
CCGGTCATCATTTTTTAATCTAAATCTTTTTTTCTTTTGTCTACATTGTACACTATAACATATTCAAACCAACATGAATTTGAGTCCATT
TTAATATTTTATTTTGGATAAGAAGAGAGGGAAAAGGTGGATCAAGGTTGTGGTTTCGTAAATCAAAATACCTTTCTATAAATAGAAAGA
TCGAAGAGGCAAAAACTGTGTTTTGGTCATTGTCATATTTCTACAAAACCCTTTCAGTTTCAAGTCTTTTCACTACTGTGTGGTAG
(5')
GTCCGTATTTGCTCCAAGGGTTTAACTTTCCCCCCAACAAATTTCTACCATGGAAACGCCTTCTTCGCAGCCCAAAAGGCgTGGCAGGCC
AAAGGGTTCTGCTGCCAAATCCAAAGACGAAAGAGAAAAGGAACCTCACAGTTCCGGCAAGATGAGAGGTAGTGCTAGCAAGAAAGCTGC
TGCTGTGGACGAGGAGTATGTTCAGTGGAAGTCACTCGTTGCTGTCCTCTATGACTGGTTCGCTAATCACAACCTCATTTGGCCTTCgCT
CTCTTGCAGGTGGXGGTGCAGTAGTTGAGGAGGGTAAATATAAAAACCGCCAGCGACTCTACCTTTCTGAACAGACGGATAAGTCAGTGC
CTAATACTTTGATCATCGCCAATTGTGATGTGGTTAAGCCCAGGGTTGCAGCAGAAAATCATATTGCAAATTTCAATGAAGAGGCACGCT
CGCCATTTGTGAAGAAGTACAAAACCATAATACATCCGGGAGAGGTTAACAGAATCAGAGAACTCCCGCAGAACAAAAACATAGTGGCAA
CCCATACTGATGGTCCTGAAGTTCTCATTTGGGACATTGAAGCTCAGCCTAACAAGCATGCTGTCTATGGTGCTGCTGCTTCGCGTCCAG
ATCTGGTATTAAGTGGACATCAGGACAATGCAGAATTTGCTCTGGCTCTGTCCCCCATGGAACCCTTTGTCCTCTCTGGAGGGAAGGACA
AGACTGTTGTATTATGGAGCATTCAAGATCACATTTCAACATTGGCAGCAGATGCAACCAAGTCTGCTGGATCTGGTGGCTCTATAATTA
AGTCTGCTGATAATCCTTCTATTGGACCACGTGGTATCTTCCATGGCCATGCGGATACCGTTGAAGATGTTCAGTTTTGTCCTTCAAGTT
CCCAGGAATTCTGTAGTGTTGGTGATGATTCATGCCTCATATTGTGGGATGCTCGTGTTGGTAACAATCCTGCTGTAAAGGTTGAGAAAG
CTCATGATGCTGATCTTCATTGTGTCGATTGGAATCCTCACAATGACAATCTTATCATAACTGGGTCCGCTGATAATTCAGTACGCTTAT
TTGACCGGCGAAATTTGACTTCAGATGGGGTTGGGTCACCAGTACATATGTTTGAACATCACACAGCTGCAGTTCTCTGTGTTCAGTGGT
GTCCGAATAGGTCTTCTGTGTTTGGGAGCTGTGCAGAGGATGGTCTCTTAAATATTTGGGACTATGAGAAGGTTGGCGCAGCAAAAGATT
CTGATATTGAATCTGATGAAGATGAAGAGGAGTCTCCTCCAGGCTTGTTTTTTCAGCATGCTGGCCACAGGGATAAGATTGTGGACTTTC
ACTGGAATGCTTGTGATCCATGGACTATTGTTAGTGTATCTGATGATGCAGAGACCTCTGGTGGAGGGGGCACATTACAGATATGGCGTA
TGATTGATATGTTGTACCGGCCGAAGGCTGAAGTTTTGGCTGAGATGCAACATTTCAAGGAcCATGTGGGCAAGTGTACCCCTAAGTGCA
AAGGCTGATGAGTGTTATTTTTGA\(3')GCAATAGTAGGCAGTAGAGATGCCATTAGTATTATTATACAAGTTAAACAGTATGTGTAAT
AGTTGGAATGGAGCATATTTATATTTGCATGTAAAAGATATGCTGGGAAATGGTAATTATGCTAGTAGACAGCAAGCCTCAAACTACCAA
AGACTGTAGAGCATGTTGTTGTATGTACTGCATATGTGCTAATTTGCTCCTTGATGTTTTGCATTTTTTTAAAAAAAAAAAAAAAAAAAA
AAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan