Notice: The contact form functionality has been restored. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U216092

Score 
1189
Direction 
Forward
Predicted Peptide Sequence 
MAAADAGGGTYSDNLWVQEFDGNSAIDVHKAEGRPLNVPLIAPFTIASSRLDKVENVAIRVELSNGCVGWGEAPILPFVTAEDQSIALAK
AAEACEFLKQSREMTLNVALTKIGDVLPGHDFASVRAGVEMALIDAAATALEYLSGDYXGGVSNAISTDITIPIVSPMEASELASKYRKQ
GFKTLKLKVGKNLNGDIEVLQSIRAAHPDCLFILDANEGYTANEAIKVLEKLHEMDVTPVLFEQPVHRDDWKGLGHVSQIAKDKYGVSVA
ADESCRSLVDAKKIVQESLADVINIKLAKVGVLGALEIIXLGEVLGLKSDDGGMVETRLAMGFAGHLAAGLGCFKFIDLDTPLLLAEDPV
FGGYEASGPDYSFSNARGHGGFLHWENIAMILVAELVHSSGLSLTT
Predicted Coding Sequence 
ATGGCGGCAGCXGACGCCGGCGGTGGCACCTACAGCGACAACCTTTGGGTTCAAGAATTTGATGGAAACAGTGCAATTGATGTTCATAAA
GCGGAAGGGAGGCCACTGAACGTGCCACTGATTGCTCCTTTTACTATTGCATCATCAAGATTGGACAAAGTGGAAAACGTAGCTATTAGG
GTTGAGTTGAGTAATGGCTGTGTTGGGTGGGGTGAAGCCCCAATTCTTCCATTTGTGACTGCAGAGGATCAATCCATTGCCTTAGCAAAA
GCGGCTGAAGCCTGTGAGTTCTTGAAGCAGAGCCGTGAAATGACTTTAAATGTTGCATTAACAAAAATTGGCGACGTGCTCCCTGGACAT
GATTTTGCTTCTGTCAGGGCAGGAGTTGAGATGGCACTGATTGATGCAGCAGCAACAGCATTGGAATACCTCTCTGGAGACTATXTTGGT
GGAGTATCTAATGCAATATCTACTGACATTACAATTCCGATTGTTTCACCCATGGAAGCTTCTGAACTGGCTTCAAAGTATCGTAAACAA
GGTTTCAAGACTTTAAAGCTTAAGGTGGGCAAGAATTTGAACGGAGACATTGAAGTGCTTCAATCCATACGTGCAGCACATCCTGATTGC
TTGTTTATCTTAGATGCTAATGAAGGTTACACGGCAAATGAAGCTATTAAAGTCCTGGAAAAGTTGCATGAAATGGATGTCACTCCGGTG
CTATTTGAACAACCTGTTCATAGAGATGATTGGAAAGGTCTTGGTCATGTCAGTCAGATTGCAAAGGACAAATATGGGGTATCTGTTGCT
GCCGATGAAAGTTGTCGAAGTTTGGTTGATGCTAAAAAGATAGTGCAAGAAAGTCTTGCTGATGTCATTAACATTAAGCTTGCCAAAGTT
GGGGTGCTTGGGGCTCTGGAAATTATTGXACTTGGTGAGGTCCTCGGGCTTAAATCTGATGATGGTGGTATGGTTGAAACCAGGCTTGCC
ATGGGCTTTGCTGGTCATCTAGCCGCTGGCCTTGGATGTTTCAAATTCATTGACCTAGACACACCCCTTCTGTTGGCAGAAGATCCAGTT
TTTGGGGGTTATGAAGCTTCTGGACCTGATTACAGCTTCTCAAATGCTAGAGGGCACGGTGGTTTTCTTCATTGGGAGAATATTGCXATG
ATATTAGTAGCGGAGCTTGTTCACTCTTCAGGATTGTCACTCACAACCTAA\
Edits in Original Sequence 
AACTAGTCTCGAGTTTTTTTTTTTTTCAAATCTTCCCTTTTCTGTCCAAAAGCCAATCAGTGAAGCTCAAATTCACTATTTACTGCAATT
CATAGAAGATGGATCGTATTGGGCTTACTCAAAACTTCCAAACTCACTGTTTCTTTCATTTTACTGCTTCTTTACGCACCCAATTGTCTA
AAGTTTCTAACTTTACCCCCAATTTCAAGAATCCCAAAGTTGTTACAGCCTGC
(5')ATGGCGGCAGCXGACGCCGGCGGTGGCACCTAC
AGCGACAACCTTTGGGTTCAAGAATTTGATGGAAACAGTGaCAATTGATGTTCATAAAGCGGAAGGGAGGCCACTGAACGTGCCACTGAT
TGCTCCTTTTACTATTGCATCATCAAGATTGGACAAAGTGGAAAACGTAGCTATTAGGGTTGAGTTGAGTAATGGCTGTGTTGGGTGGGG
TGAAGCCCCAATTCTTCCATTTGTGACTGCAGAGGATCAATCCATTGCCTTAGCAAAAGCGGCTGAAGCCTGTGAGTTCTTGAAGCAGAG
CCGTGAAATGACTTTAAATGTTGCATTAACAAAAATTGGCGACGTGCTCCCTGGACATGATTTTGCTTCTGTCAGGGCAGGAGTTGAGAT
GGCACTGATTGATGCAGCAGCgAACAGCATTGGAATACCTCTCTGGAGACTATXTTGGTGGAGTATCTAATGCAATATCTACTGACATTA
CAATTCCGATTGTTTCACCCATGGAAGCTTCTGAACTGGCTTCAAAGTATCGTAAACAAGGTTTCAAGACTTTAAAGCTTAAGGTGGGCA
AGAATTTGAACGGAGACATTGAAGTGCTTCAATCCATACGTGCAGCACATCCTGATTGCTTGTTTATCTTAGATGCTAATGAAGGTTACA
CGGCAAATGAAGCTATTAAAGTCCTGGAAAAGTTGCATGAAATGGATGTCACTCCGGTGCTATTTGAACAACCTGTTCATAGAGATGATT
GGAAAGGTCTTGGTCATGTCAGTCAGATTGCAAAGGACAAATATGGGGTATCTGTTGCTGCCGATGAAAGTTGTCGAAGTTTGGTTGATG
CTAAAAAGATAGTGCAAGAAAGTCTTGCTGATGTCATTAACATTAAGCTTGCCAAAGTTGGGGTGCTTGGGGCTCTGGAAATTATTGXAC
TTGGTGAGGTCCTCGGGCTTAAATCTGATGATcGGTGGTATGGTTGAAACCAGGCTTGCCATGGGCTTTGCTGGTCATCTAGCCGCTGGC
CTTGGATGTTTCAAATTCATTGACCTAGACACACCCCTTCTGTTGGCAGAAGATCCAGTTTTTGGGGGTTATGAAGCTTCTGGACCTGAT
TACAGCTTCTCAAATGCTAGAGGGCACGGTGGTTTTCTTCATTGGGAGAATATTGCXATGATATTAGTAGCGGAGCTTGTTCACTCTTCA
GGATTGTCACTCACAACCTAA\(3')TTATAGTTATGCATATGTACTTGTGAATTAGTCGTTGGTAAATTTGAAATGTTTATGTGCCAAA
GAATTGGAACACAATGCTAGAATATCCAATCTTTAGAGTAAACAAATATGTAAATGTCTTATTGTCTGTTGAAATTGATGTTAGTTGAGA
ACGTCTTGCTTGATCTTCTCTTTGACAATCTCAACAAATATTAAATCAATCTGCCAGACTCTTGGTACTAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan