ESTScan Details for Unigene SGN-U216112

Score 
924
Direction 
Forward
Predicted Peptide Sequence 
YFFKFARRANGVNAGKIELWKFSVSTKCSRACQTAPNQYSGQDVRPQQESLVVSSGASVPVIDLQKLISGNTIDSELQKLHSACQEWGFL
QVXKPWSDTFVTGGLQERGYSIVQTSNGRKEETVATERQLEGFGHMFVVSEEQKLDWSDMFGIINLPPHIRKVDLFQKLPSKLRDIMEAY
SKEIKNLTMIIVCQLAKALRMDEKEMRDLFSDGMQSIRMNYYPPCPEPDRAIGLSPHSDADALTILFQLNETEGLQVRKDDIWVPITPLP
NALIVNIGDMMEIVSNGVYRSIEHRAIVNSYEERLSVATFYNINLESELGPAHSLIGPHNPPIFRRVPVQKYLQDFFARKLDGKSYLDSM
KVDARDDES
Predicted Coding Sequence 
XXTTATTTTTTCAAGTTTGCAAGAAGAGCAAATGGAGTCAACGCCGGAAAAATTGAACTTTGGAAATTCTCTGTTAGTACCAAGTGTTCA
AGAGCTTGCCAAACAGCACCTAACCAATATTCCGGACAGGATGTCCGCCCACAACAAGAATCTCTGGTCGTATCTTCCGGAGCATCAGTT
CCAGTTATCGATCTTCAAAAGTTGATTTCAGGGAATACCATAGATTCTGAGCTACAAAAGCTTCACTCTGCTTGCCAAGAATGGGGTTTC
CTACAGGTTGXTAAACCATGGAGTGACACCTTCGTTACTGGAGGACTTCAAGAGAGAGGTTATTCAATTGTTCAAACTTCCAATGGAAGA
AAAGAAGAAACTGTGGCAACAGAAAGACAGCTTGAAGGTTTCGGGCATATGTTTGTTGTATCGGAGGAGCAGAAGCTTGATTGGAGTGAC
ATGTTTGGCATAATAAATCTTCCTCCTCATATCCGCAAAGTGGACTTGTTTCAGAAGTTGCCCTCGAAGCTCAGAGACATCATGGAAGCA
TATTCCAAAGAAATCAAGAACCTAACAATGATCATCGTATGTCAATTGGCCAAGGCTTTAAGGATGGATGAAAAAGAAATGCGAGATCTA
TTCAGTGATGGTATGCAGTCAATAAGGATGAATTATTATCCCCCTTGTCCTGAGCCAGACAGGGCAATTGGCTTAAGCCCTCATTCTGAT
GCAGATGCCCTCACCATCCTCTTCCAGCTCAATGAAACTGAAGGTCTCCAAGTCCGAAAAGACGATATTTGGGTGCCTATAACGCCCCTC
CCAAATGCTTTGATTGTCAATATTGGCGATATGATGGAGATAGTGAGCAATGGTGTCTATAGGAGCATTGAGCATAGAGCAATTGTAAAC
TCATATGAAGAACGTCTCTCTGTTGCAACATTCTACAACATCAACCTTGAGTCCGAGTTAGGACCTGCACACAGCCTTATTGGACCACAT
AATCCTCCCATTTTCCGAAGAGTTCCTGTGCAAAAATATTTACAGGACTTTTTTGCACGAAAACTTGATGGAAAATCGTATCTTGATTCC
ATGAAGGTCGACGCGAGGGATGATGAATCATAG\
Edits in Original Sequence 
(5')XXTTATTTTTTCAAGTTTGCAAGAAGAGCAAATGGAGTCAACGCCGGAAAAATTGAACTTTGGAAATTCTCTGTTAGTACCAAGTG
TTCAAGAGCTTGCCAAACAGCACCTAACCAATATTCCGGACAGGtATGTCCGCCCACAACAAGAATCTCTGGTCGTATCTTCCGGAGCAT
CAGTTCCAGTTATCGATCTTCAAAAGTTGATTTCAGGGAATACCATAGATTCTGAGCTACAAAAGCTTCACTCTGCTTGCCAAGAATGGG
GTTTCCTACAGGTTGXTAAACCATGGAGTGACACCTTCGTTACTGGAGGACTTCAAGAGAGAGGTTATTCAATTGTTCAAACTTCCAATG
GAAGAAAAGAAGAAACTGTGGCAACAGAAAGACAGCtTTGAAGGTTTCGGGCATATGTTTGTTGTATCGGAGGAGCAGAAGCTTGATTGG
AGTGACATGTTTGGCATAATAAATCTTCCTCCTCATATCCGCAAAGTGGACTTGTTTCAGAAGTTGCCCTCGAAGCTCAGAGACATCATG
GAAGCATATTCCAAAGAAATCAAGAACCTAACAATGATCATCGTATGTCAATTGGCCAAGGCTTTAAGGATGGATGAAAAAGAAATGCGA
GATCTATTCAGTGATGGTATGCAGTCAATAAGGATGAATTATTATCCCCCTTGTCCTGAGCCAGACAGGGCAATTGGCTTAAGCCCTCAT
TCTGATGCAGATGCCCTCACCATCCTCTTCCAGCTCAATGAAACTGAAGGTCTCCAAGTCCGAAAAGACGATATTTGGGTGCCTATAACG
CCCCTCCCAAATGCTTTGATTGTCAATATTGGCGATATGATGGAGATAGTGAGCAATGGTGTCTATAGGAGCATTGAGCATAGAGCAATT
GTAAACTCATATGAAGAACGTCTCTCTGTTGCAACATTCTACAACATCAACCTTGAGTCCGAGTTAGGACCTGCACACAGCCTTATTGGA
CCACATAATCCTCCCATTTTCCGAAGAGTTCCTGTGCAAAAATATTTACAGGACTTTTTTGCACGAAAACTTGATGGAAAATCGTATCTT
GATTCCATGAAGGTCGACGCGAGGGATGATGAATCATAG\(3')GTAGAATCTGATATATGTCTGTCTTGTTGTTGTAATTTGGAGTTCC
CCTGTTTTCTATTTGTTAGCTGTATTGACGTGAAGCAAATATTAATATGTGGATTGCTTTAGACACTATATTTTTGGGTTGAGAGGAATT
TCCATGAATTTATTTTAGAGGAAAATACACGACTATCCCCTAAAAGTTGCAGTGAAGTCGAATCGTACTAAAGATAAAATTATTTTTAAA
AAATAGTAAAGTTAATTTTTTTTCTCGATAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan