Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U216241

Score 
1654
Direction 
Forward
Predicted Peptide Sequence 
MVESSVGGVVPAVKGEVMRRMGDKEEGGSVTLRDEEVGTVTEWELDRELLCPICMQIIKDAFLTACGHSFCYMCIVTHLHNKSDCPCCSH
YLTTSQLYPNFLLDKLLKKTSARQISKTASPVEXVSSFIGTDRVLKCQLGAGRSIVDVVREKEEIGTGGSRAKYANSARLLTDVKEEKVD
ELNEVQHDLQYIKEDLNSVERHRIDLYRARDRYSMKLRMLADDPIGKKPWSSSTDRNFGGLFSTSRNAPGGLPTGNLTFKKVDSKAQISS
PGPQRKDTSISELNSQHMSQSGLAVVRKKRVNAQFNDLQECYLQKRRQLANKSRVKEEKDADVVQREGYSEGLADFQSVLSTFTRYSRLR
VIAELRHGDLFHSANIVSSIEFDRDDELFATAGVSRRIKVFDFSSVVNEPADAHCPVVEMSTRSKLSCLSWNKYTKNHIASSDYDGIVTV
WDVTTRQSVMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVKVWCTKQEASVLNIDMKANICCVKYNPGSSVHIAVGSADHHIHYYDLRN
TSQPVHIFSGHRKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTLRGHTNEKNFVGLSVNNEFLSCGSETNEVFVYHKAISKPVTW
HRFGSPDIDEADEDAGSYFISAVCWKSDSPTMLAANSQGTIKVLSLQLDEVNKATS
Predicted Coding Sequence 
ATGGTGGAAAGTTCAGTTGGAGGGGTGGTGCCAGCAGTGAAGGGGGAGGTGATGAGGAGGATGGGGGACAAAGAGGAGGGGGGTAGTGTA
ACTCTAAGGGATGAAGAAGTTGGGACAGTGACAGAATGGGAATTGGACAGGGAATTGTTGTGTCCTATATGTATGCAGATCATAAAGGAT
GCATTTTTAACAGCTTGTGGGCACAGTTTTTGCTATATGTGCATAGTTACTCATCTTCACAACAAGAGTGATTGCCCCTGTTGTTCTCAT
TATCTCACTACCAGTCAACTCTATCCCAATTTCCTACTTGACAAGCTATTGAAGAAGACATCTGCCCGTCAGATTTCAAAAACTGCATCC
CCTGTTGAAXCAGTTTCGTCATTCATTGGAACAGACAGGGTTCTGAAGTGTCAATTAGGAGCTGGACGCTCTATTGTTGATGTTGTCAGA
GAAAAAGAGGAAATTGGAACAGGAGGAAGCAGAGCGAAATATGCAAATTCTGCTAGACTTCTTACAGATGTTAAGGAAGAAAAAGTTGAT
GAACTCAATGAGGTGCAACATGATCTGCAATACATCAAAGAGGACTTAAATTCAGTAGAGAGACATAGAATAGACCTATACCGGGCTAGG
GACCGGTATTCAATGAAGCTCCGAATGTTAGCAGATGATCCTATTGGGAAAAAACCTTGGTCTTCATCAACTGATAGGAACTTTGGTGGT
CTTTTCTCCACTTCACGAAATGCACCTGGAGGATTACCGACTGGAAACTTGACATTCAAAAAGGTGGACAGCAAAGCTCAAATAAGCTCT
CCTGGACCACAGAGAAAAGATACTTCAATCAGTGAACTGAACTCACAACATATGAGTCAATCAGGTCTGGCTGTGGTTAGGAAGAAGCGT
GTCAATGCACAGTTCAATGATCTCCAAGAATGTTACTTGCAAAAGAGACGTCAATTGGCAAACAAATCGCGAGTTAAGGAAGAAAAGGAT
GCAGATGTCGTACAAAGAGAAGGTTACAGTGAAGGACTAGCAGATTTTCAGTCTGTACTTAGCACTTTCACTCGTTATAGTCGGTTAAGA
GTCATTGCTGAACTTCGGCATGGGGATCTGTTTCACTCGGCCAATATTGTTTCAAGCATTGAATTTGATCGGGATGATGAGTTGTTTGCT
ACTGCTGGAGTTTCACGGCGTATAAAAGTTTTTGACTTCTCTTCAGTTGTAAATGAACCTGCAGATGCACACTGCCCTGTTGTTGAAATG
TCTACCCGATCTAAGCTGAGCTGCTTGAGTTGGAATAAGTATACCAAGAACCACATAGCTAGTAGTGATTATGATGGAATAGTAACTGTA
TGGGATGTGACGACTAGACAGAGTGTGATGGAATATGAAGAGCATGAGAAACGGGCTTGGAGTGTTGATTTTTCACGCACAGAACCCTCG
ATGCTTGTATCTGGCAGTGATGATTGTAAGGTCAAAGTTTGGTGCACGAAGCAGGAAGCAAGTGTTCTTAATATTGACATGAAGGCAAAT
ATATGCTGTGTAAAATATAATCCTGGATCTAGTGTTCATATAGCGGTTGGCTCTGCGGATCATCATATTCATTATTATGACTTGAGGAAC
ACCAGCCAGCCGGTTCACATTTTTAGTGGCCATAGAAAAGCTGTTTCATATGTAAAATTTTTGTCCAACAATGAACTTGCTTCAGCATCA
ACAGACAGTACTCTACGATTGTGGGATGTAAAAGATAATTTGCCGGTTCGCACGCTTAGAGGACATACGAATGAGAAGAACTTTGTTGGT
CTCTCAGTGAACAATGAATTCCTGTCATGTGGCAGTGAAACAAATGAAGTATTCGTGTACCATAAGGCGATATCCAAACCCGTGACTTGG
CATAGATTTGGTTCCCCAGACATAGACGAAGCGGATGAAGATGCAGGATCTTATTTCATCAGCGCAGTGTGCTGGAAGAGCGATAGCCCT
ACGATGCTAGCTGCTAATAGCCAGGGAACTATAAAAGTGTTGTCCTTGCAGCTTGATGAAGTTAATAAAGCTACTAGTTAA\
Edits in Original Sequence 
ACTGATGAACAGTCAAGAACTTGTTTGGGGTTGAAGTATAGTTGATTCTTGAAAATACCCAATTTGCAAAAACTTGTTTTGGGTTGAGGG
GTAGTTGATTCTTGAAAAATACCCAATTTGCTAAGAACTTGTTTGGGGTTGAGGGGTAGTTGATTATTGAAAAATACCCAATTTTGCTAA
AAAGTTGTTTGGGGTTGAGGGGTAGTTGATTATTGAAAAATACCCAATTTGCAGTTGGGGGTATAGAGGGAG
(5')ATGGTGGAAAGTTC
AGTTGGAGGGGTGGTGCCAGCAGTGAAGGGGGAGGTGATGAGGAGGATGGGGGACAAAGAGGAGGGGGGTAGTGTAACTCTAAGGGATGA
AGAAGTTGGGACAGTGACAGAATGGGAATTGGACAGGGAATTGTTGTGTCCTATATGTATGCAGATCATAAAGGATGCATTTTTAACAGC
TTGTGGGCACAGTTTTTGCTATATGTGCATAGTTACTCATCTTCACAACAAGAGTGATTGCCCCTGTTGTTCTCATTATCTCACTACCAG
TCAACTCTATCCCAATTTCCTACTTGACAAGCTATTGAAGAAGACATCTGCCCGTCAGATTTCAAAAACTGCATCCCCTGTTGAAXCAGT
TTCGTCATTCATTGGAACAGACAGGGTTCTGAAGTGTCAATTaAGGAGCTGGACGCTCTATTGTTGATGTTGTCAGAGAAAAAGAGGAAA
TTGGAACAGGAGGAAGCAGAGCGAAATATGCAAATTCTGCTAGACTTCTTACAGATGTTAAGGAAGcAAAAAGTTGATGAACTCAATGAG
GTGCAACATGATCTGCAATACATCAAAGAGGACTTAAATTCAGTAGAGAGACATAGAATAGACCTATACCGGGCTAGGGACCGGTATTCA
ATGAAGCTCCGAATGTTAGCAGATGATCCTATTGGGAAAAAACCTTGGTCTTCATCAACTGATAGGAACTTTGGTGGTCTTTTCTCCACT
TCACGAAATGCACCTGGAGGATTACCGACTGGAAACTTGACATTCAAAAAGGTGGACAGCAAAGCTCAAATAAGCTCTCCTGGACCACAG
AGAAAAGATACTTCAATCAGTGAACTGAACTCACAACATATGAGTCAATCAGGTCTGGCTGTGGTTAGGAAGAAGCGTGTCAATGCACAG
TTCAATGATCTCCAAGAATGTTACTTGCAAAAGAGACGTCAATTGGCAAACAAATCGCGAGTTAAGGAAGAAAAGGATGCAGATGTCGTA
CAAAGAGAAGGTTACAGTGAAGGACTAGCAGATTTTCAGTCTGTACTTAGCACTTTCACTCGTTATAGTCGGTTAAGAGTCATTGCTGAA
CTTCGGCATGGGGATCTGTTTCACTCGGCCAATATTGTTTCAAGCATTGAATTTGATCGGGATGATGAGTTGTTTGCTACTGCTGGAGTT
TCACGGCGTATAAAAGTTTTTGACTTCTCTTCAGTTGTAAATGAACCTGCAGATGCACACTGCCCTGTTGTTGAAATGTCTACCCGATCT
AAGCTGAGCTGCTTGAGTTGGAATAAGTATACCAAGAACCACATAGCTAGTAGTGATTATGATGGAATAGTAACTGTATGGGATGTGACG
ACTAGACAGAGTGTGATGGAATATGAAGAGCATGAGAAACGGGCTTGGAGTGTTGATTTTTCACGCACAGAACCCTCGATGCTTGTATCT
GGCAGTGATGATTGTAAGGTCAAAGTTTGGTGCACGAAGCAGGAAGCAAGTGTTCTTAATATTGACATGAAGGCAAATATATGCTGTGTA
AAATATAATCCTGGATCTAGTGTTCATATAGCGGTTGGCTCTGCGGATCATCATATTCATTATTATGACTTGAGGAACACCAGCCAGCCG
GTTCACATTTTTAGTGGCCATAGAAAAGCTGTTTCATATGTAAAATTTTTGTCCAACAATGAACTTGCTTCAGCATCAACAGACAGTACT
CTACGATTGTGGGATGTAAAAGATAATTTGCCGGTTCGCACGCTTAGAGGACATACGAATGAGAAGAACTTTGTTGGTCTCTCAGTGAAC
AATGAATTCCTGTCATGTGGCAGTGAAACAAATGAAGTATTCGTGTACCATAAGGCGATATCCAAACCCGTGACTTGGCATAGATTTGGT
TCCCCAGACATAGACGAAGCGGATGAAGATGCAGGATCTTATTTCATCAGCGCAGTGTGCTGGAAGAGCGATAGCCCTACGATGCTAGCT
GCTAATAGCCAGGGAACTATAAAAGTGTTaGTCCTTGCAGCTTGATGAAGTTAATAAAGCTACTAGTTAA\(3')GAATGTTCAAATCTT
TTTAGTGGAAAAACAGTGAAATGGAATTTCACATTCAATTTTTCCTGTAGATATCTATTCAACCATCAAGATGGCATGGTTCCCCCCATA
TTTGTCAATGTATTCATCATTAAAACATGTAACACAAGTTGTAGGGCTTGGTAAATTTAGAAGAATTTTACAAGTTTGTGTTTTTTTTTT
TCATTGTGCTGAAGGACATCGGATTTACACACCATTTCATGGAATAAACTTTACTCGTATTCAGTGTTTACACCAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan