ESTScan Details for Unigene SGN-U216294

Score 
702
Direction 
Forward
Predicted Peptide Sequence 
MPKERRDRSVSFDGAELLLTVVARVTQGXSLSKNPLENEENVKDWEDARCPVCMEHPHNAILLLCASHEKGCRPFMCDTSYRHSNCFDQF
KKSFEEASASTTQQVEIPASASITESTVTLSEALSELPGERTEGGSISLDALSCENHEIKKMLCPLCRGQINDWIVVDSARRHMNAKLRS
CSSETCEFSGTYTDLRKHARQEHPLVRPTEADPERQRSWRRLERQRDLGDLLSTLQSSVSEEGSESTSLTFDEGGLLTVFLFVRILQPGV
VLGVVAGQVPQEPGAQATGRRRPSRRLWGETYEGEIDTRDDENDDSDGGSGPPETPASTTNPRKLVLAANMCLLAIPFECYRCGGKPRGP
KYVVLKAGESLLGYKIRMENCVW
Predicted Coding Sequence 
ATGCCTAAGGAGAGAAGAGATAGGTCTGTTTCTTTTGATGGAGCAGAGCTTCTCCTTACTGTTGTAGCTCGAGTCACTCAAGGTXCATCA
TTGTCCAAAAACCCTTTGGAAAATGAGGAAAATGTGAAGGACTGGGAAGATGCTCGATGCCCAGTGTGTATGGAACATCCTCATAATGCT
ATTCTCCTTCTGTGTGCCTCTCATGAGAAGGGCTGTCGTCCTTTTATGTGTGACACAAGTTATAGGCATTCAAATTGTTTTGATCAGTTC
AAAAAGTCATTTGAAGAAGCTTCAGCATCAACAACTCAGCAAGTGGAGATTCCAGCTTCAGCTTCTATTACGGAATCTACTGTAACGTTA
TCAGAAGCTCTGTCTGAACTTCCAGGTGAAAGGACCGAAGGTGGTTCTATATCCCTAGATGCCTTGTCTTGCGAGAACCATGAAATAAAG
AAGATGCTATGCCCTCTCTGCCGTGGCCAGATAAATGATTGGATTGTTGTAGACTCTGCCCGTCGTCACATGAATGCCAAATTAAGAAGC
TGCTCTAGCGAGACATGCGAGTTCAGTGGCACATATACAGATTTGCGTAAGCATGCTAGGCAGGAGCATCCTCTTGTACGTCCTACAGAA
GCTGACCCAGAGAGGCAGCGCAGTTGGAGGAGGCTGGAACGACAGAGAGATTTAGGAGATCTGCTCAGTACATTGCAGTCATCTGTTTCA
GAAGAGGGTAGTGAAAGCACCAGTTTAACCTTTGATGAGGGTGGTTTGCTGACTGTTTTTCTCTTTGTTCGGATTCTCCAACCTGGAGTA
GTTCTCGGAGTAGTAGCTGGTCAGGTTCCTCAAGAACCCGGXGCTCAGGCAACTGGGAGGAGACGACCTTCAAGAAGACTTTGGGGTGAA
ACTTATGAAGGGGAAATTGATACTAGGGATGACGAGAATGACGACTCTGATGGAGGATCAGGTCCXCCGGAGACGCCTGCGTCGACAACC
AACCCCAGAAAATTAGTTCTGGCTGCAAACATGTGTTTGCTTGCTATTCCTTTTGAATGTTACCGCTGTGGAGGGAAACCTCGTGGTCCA
AAATATGTCGTGCTGAAAGCTGGGGAATCGCTTCTTGGATACAAGATTCGGATGGAAAATTGTGTTTGG\
Edits in Original Sequence 
CAACTCAGCTGCAGCCTTTTCAGAGTTGTTCAAAAGCACTAGGGTTTCAGAAAAATTCGATCTTCAGAGTACTGAATCATCACAAAGGAA
GATTCTACGATAAGGGTTGTTCAGTTCGATCTTTAAAACACTGAATTATCACAAAGGATTTCTACGATAAGGGTTGTTCACATCGGTGTT
TGTAAAACATCTGTTCTATTTTCTTATAGAAACTAAAC
(5')ATGCCTAAGGAGAGAAGAGATAGGTCTGTTTCTTTTGATaGGAGCAGA
GCTTCTCCTTACTGTTGTAGCTCGAGTCACTCAAGGTXCATCATTGTCCAAAAACCCTTTGGAAAATGAGGAAAATGTGAAGGACTGGGA
AGATGCTCGATGCCCAGTGTGTATGGAACATCCTCATAATGCTATTCTCCTTCTGTGTGCCTCTCATGAGAAGGGCTGTCGTCCTTTTAT
GTGTGACACAAGTTATAGGCATTCAAATTGTTTTGATCAGTTCAAAAAGTCATTTGAAGAAGCTTCAGCATCAACAACTCAGCAAGTGGA
GATTCCAGCTTCAGCTTCTATTACGGAATCTACTGTAACGTTATCAGAAGCTCTGTCTGAACTTCCAGGTGAAAGGACCGAAGGTGGTTC
TATATCCCTAGATGCCTTGTCTTGCGAGAACCATGAAATAAAGAAGATGCTATGCCCTCTCTGCCGTGGCCAGATAAATGATTGGATTGT
TGTAGACTCTGCCCGTCGTCACATGAATGCCAAATTAAGAAGCTGCTCTAGCGAGACATGCGAGTTCAGTGGCACATATACAGATTTGCG
TAAGCATGCTAGGCAGGAGCATCCTCTTGTACGTCCTACAGAAGCTGACCCAGAGAGGCAGCGCAGTTGGAGGAGGCTGGAACGACAGAG
AGATTTAGGAGATCTGCTCAGTACATTGCAGTCATCTGTTTCAGAAGAGGGTAGTGAAAGCACCAGTTTAACCTTTGATGAGGGTGGTTT
GCTGACTGTTTTTCTCTTTGTTCGGATTCTCCAACCTaGGAGTAGTTCTCGGAGTAGTAGCTGGTCAGGTTCCTCAAGAACCCGGXGCTC
AGGCAACTGGGAGGAGACGACCTTCAAGAAGACTTTGGGGTGAAACTTATGAAGGGGAAATTGATACTAGGGATGACGAGAATGACGACT
CTGATGGAGGATCAGGTCCXCCGGAGACGCCTGCGTCGACAACCAACCCCAGAAAATTAGTTCTGGCTGCAAACATGTGTTTGCTTGCTA
TTCCTTTTGAATGTTACCGCTGTGGAGGGAAACCTCGTGGTCCAAAATATGTCGTGCTGAAAGCTGGGGAATCGCTTCTTGGATACAAGA
TTCGGATGGAAAATTGTGTTTGG\(3')TTAGTAGTATAACTTGTATACATGTCCTTCTTGATGAAATCTCATCTCATCCTGTGTGCTAT
GCAAATGCTTTATATCTACTTGAATTGATAAAGTTGGAAAGCAATTTGCTAGTTTTGCTTAAAAAAAAAAAAAAAAAGACACCTCGAGAC
TAGTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan