ESTScan Details for Unigene SGN-U216416

Score 
906
Direction 
Forward
Predicted Peptide Sequence 
MGRAEDDEPPPKRVKVSSRKGDLPKSTLLTDPASCSLNDLMAHPLVRQGDDEVVGAKGVVKKVEFVRIVAEALYSLGYNKAGARLEEESG
IPLQSAEVKLFMQQILDGKWDESVATLHKIGLIDEKIVKLASFEILEQKFFELLDGKNVMDALKTLRTELGPXLLNNDRVRELSLCILSP
LQQVLAGMSGQDVXATKVTNKTPRGIAEIASTAVIIREQRLVHLVEQALDLQLDACRFHNSLVGEMSLLTDHHAEXDQIPSQTLQILQDH
GDEVWFLQFSHGGKYLASSAADCLVIIWEVKLDGFFCVKHRFSGHQKPVSNISWSPDDHQLLTCGVEEVVRRWDVESRECIHIYEKNGLG
LISCGWAPDGNRILCGVTDKSISMWDLEGKELECWKGHRTIRISDLGITSDGKHVVSVCKDNMILLFGWESKAEKVIQEDQTVTSFVLST
DNKYLLVSLWNQEIHLWDIEGTAKLISKYNGHKRSRFVIRSCFGGLNQEFISSGSEDSQVYIWHISSGELVETLAGHSGTVNCVSWNPAD
PHMLASASDDHTIRIWGLNQVKMEHNDTVSNGVTTAMGELRSVSVGELVRCFTGYFIGCVDLHSR
Predicted Coding Sequence 
ATGGGACGTGCAGAGGATGATGAACCACCACCAAAACGTGTGAAGGTATCCTCCAGAAAGGGAGATCTTCCAAAGAGTACACTTCTGACT
GATCCTGCAAGTTGCTCACTGAATGACTTGATGGCTCACCCCCTGGTTCGTCAAGGGGACGATGAGGTCGTTGGTGCAAAAGGGGTTGTT
AAGAAAGTTGAATTTGTGCGAATCGTAGCAGAGGCATTATATTCTCTTGGTTATAACAAAGCTGGTGCACGTCTAGAAGAAGAGTCTGGG
ATTCCTTTGCAATCTGCTGAAGTAAAGTTATTTATGCAGCAAATCCTTGATGGTAAATGGGATGAAAGTGTTGCCACTTTACATAAAATT
GGTCTAATAGATGAAAAAATTGTTAAATTGGCATCATTTGAGATATTGGAACAGAAGTTTTTTGAACTGTTGGATGGAAAAAATGTCATG
GATGCTTTGAAGACATTGAGGACTGAGCTTGGACCTXCTTTGCTAAACAATGATAGAGTCCGTGAGCTTTCTTTGTGCATTCTATCACCT
TTACAGCAGGTTCTTGCTGGGATGTCAGGTCAAGATGTTGXTGCGACCAAAGTCACGAACAAAACTCCTAGGGGAATTGCAGAAATTGCT
TCCACCGCGGTCATAATTCGTGAACAAAGATTGGTACATCTCGTCGAACAGGCTCTTGACTTGCAACTAGATGCTTGTAGGTTTCACAAC
TCGTTGGTAGGTGAGATGTCTTTGCTTACTGATCATCATGCGGAAGAXGATCAAATTCCATCTCAAACTTTGCAGATATTACAAGATCAC
GGTGATGAAGTATGGTTCTTACAGTTCTCCCACGGTGGAAAATACTTGGCCTCGTCAGCTGCTGATTGTTTGGTGATCATATGGGAGGTG
AAATTGGATGGTTTTTTCTGTGTGAAGCACCGGTTTTCTGGACACCAGAAACCTGTCTCCAATATTTCATGGAGTCCTGATGACCATCAA
CTCCTTACTTGTGGGGTAGAGGAAGTTGTCAGACGATGGGATGTTGAATCACGTGAATGTATACATATTTATGAGAAAAATGGTCTTGGT
TTGATCTCGTGTGGATGGGCTCCTGATGGGAACAGGATATTATGCGGTGTTACAGACAAAAGCATTAGCATGTGGGATCTGGAAGGGAAA
GAGTTGGAGTGTTGGAAAGGCCATCGGACTATTAGAATATCAGACTTGGGGATAACTAGTGACGGGAAGCATGTAGTCTCTGTTTGTAAA
GATAATATGATACTATTATTTGGATGGGAATCAAAAGCAGAGAAAGTTATTCAGGAGGATCAAACAGTAACATCATTTGTACTGTCCACA
GACAATAAGTATTTATTGGTTAGCCTTTGGAATCAAGAAATTCATCTGTGGGATATAGAGGGAACTGCAAAACTCATATCCAAATATAAT
GGGCATAAACGTTCACGCTTCGTCATAAGATCTTGCTTTGGCGGACTGAATCAAGAATTTATTTCTAGTGGAAGTGAGGACTCCCAGGTT
TATATATGGCACATAAGCTCAGGAGAACTTGTTGAGACGTTGGCGGGACATTCTGGAACAGTAAACTGTGTTAGCTGGAATCCAGCAGAT
CCTCATATGTTGGCTTCTGCTAGTGATGATCATACAATTCGCATATGGGGTTTGAATCAAGTAAAAATGGAACACAATGACACAGTTAGT
AATGGTGTCACTACTGCAATGGGGGAACTTAGAAGTGTTTCCGTCGGAGAATTAGTTAGATGCTTTACTGGTTACTTCATTGGATGTGTT
GATCTGCATTCTAGATAA\
Edits in Original Sequence 
AAAGACCCAATCTCTACATATTGTGCCTCTCGGACCTCATCATCATCGTTTGTGTCTATTCCCCTGTTTGTTTATCAATTCCTTGATTGC
TTACCCACTATTCGATCTTCATTTTGATCTGAAACCTCAGGGGTGCTGTTTTCATCATTGAAGGAACTGATATTGCAATTTCTACTTGAA
GTTCTGTTTTCCCCCTGTTGTTATATATGGGCTGAAGTATATATTT
(5')ATGGGACGTGCAGAGGATGATGAACCACCACCAAAACGTG
TGAAGGTATCCTCCAGAAAGGGAGATCTTCCAAAGAGTACACTTCTGACTGATCCTGCAAGTTGCTCACTGAATGACTTGATGGCTCACC
CCCTGGTTCGTCAAGGGGACGATGAGGTCGTTGGTGCAAAAGGGGTTGTTAAGAAAGTTGAATTTGTGCGAATCGTAGCAGAGGCATTAT
ATTCTCTTGGTTATAACAAAGCTGGTGCACGTCTAGAAGAAGAGTCTGGGATTCCTTTGCAATCTGCTGAAGTAAAGTTATTTATGCAGC
AAATCCTTGATGGTAAATGGGATGAAAGTGTTGCCACTTTACATAAAATTGGTCTAATAGATGAAAAAATTGTTAAATTGGCATCATTTG
AGATATTGGAACAGAAGTTTTTTGAACTGTTGGATGGAAAAAATGTCATGGATGCTTTGAAGACATTGAGGACTGAGCTTGGACCTXCTT
TGCgTAAACAATGATAGAGTCCGTGAGCTTTCTTTGTGCATTCTATCACCTTTACAGCAGGTTCTTGCTGGGATGTCAGGTCAAGATGTT
GXTGCGACCAAAGTCACGAACAAAACTCCTAGGGGAATTGCAGAAATTGCTTCCAcCCGCGGTCATAATTCGTGAACAAAGATTGGTACA
TCTCGTCGAACAGGCTCTTGACTTGCAACTAGATGCTTGTAGGTTTCACAACTCGTTGGTAGGTGAGATGTCTTTGCTTACTGATCATCA
gTGCGGAAGAXGATCAAATTCCATCTCAAACTTTGCAGATATTACAAGATCACGGTGATGAAGTATGGTTCTTACAGTTCTCCCACGGTG
GAAAATACTTGGCCTCGTCAGCTGCTGATTGTTTGGTGATCATATGGGAGGTGAAATTGGATGGTTTTTTCTGTGTGAAGCACCGGTTTT
CTGGACACCAGAAACCTGTCTCCAATATTTCATGGAGTCCTGATGACCATCAACTCCTTACTTGTGGGGTAGAGGAAGTTGTCAGACGAT
GGGATGTTGAATCACGTGAATGTATACATATTTATGAGAAAAATGGTCTTGGTTTGATCTCGTGTGGATGGGCTCCTGATGGGAACAGGA
TATTATGCGGTGTTACAGACAAAAGCATTAGCATGTGGGATCTGGAAGGGAAAGAGTTGGAGTGTTGGAAAGGCCATCGGACTATTAGAA
TATCAGACTTGGGGATAACTAGTGACGGGAAGCATGTAGTCTCTGTTTGTAAAGATAATATGATACTATTATTTGGATGGGAATCAAAAG
CAGAGAAAGTTATTCAGGAGGATCAAACAGTAACATCATTTGTACTGTCCACAGACAATAAGTATTTATTGGTTAGCCTTTGGAATCAAG
AAATTCATCTGTGGGATATAGAGGGAACTGCAAAACTCATATCCAAATATAATGGGCATAAACGTTCACGCTTCGTCATAAGATCTTGCT
TTGGCGGACTGAATCAAGAATTTATTTCTAGTGGAAGTGAGGACTCCCAGGTTTATATATGGCACATAAGCTCAGGAGAACTTGTTGAGA
CGTTGGCGGGACATTCTGGAACAGTAAACTGTGTTAGCTGGAATCCAGCAGATCCTCATATGTTGGCTTCTGCTAGTGATGATCATACAA
TTCGCATATGGGGTTTGAATCAAGTAAAAATGGAACACAATGACACAGTTAGTAATGGTGTaCACTACTGCAATGGGGGAACTTAGAAGT
GTTTCCGTCGGAGAATTAGTTAGATGCTTTACTGGTTACTTCATTGGATGTGTTGATCTGCATTCTAGATAA\(3')GTTGCTATTCAAC
TATGTGAGCAGCTTAGACTTTATACAGGTTACATGACATGATGAGGGCAGTTTGCTTTAATATTAGCTGTTTTAGTTTATCCATATTTGT
GGTCAATATGGTGTTCTTTAAGTGAACAAATTCACAAAATGGAGATACAATTGGATCTATCAACTGTTATGTTTTCCAAAAAAAAAAAAA
AAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan