ESTScan Details for Unigene SGN-U216420

Score 
352
Direction 
Forward
Predicted Peptide Sequence 
MSSKIACFIVLCMIVVAPHGEALSCGQVESGLAPCLPYLQGKGPLGGCCRGVKGLLGAAKTPADRKTACTCLKSAANAIKGLNLGKAAGI
PSACGVSIPYKISPFTAARRFSKVDESSIFQGIIGEK
Predicted Coding Sequence 
ATGTCTAGCAAAATTGCATGCTTTATTGTTTTGTGCATGATAGTGGTTGCACCCCATGGAGAAGCACTAAGTTGCGGCCAGGTTGAATCT
GGCTTAGCTCCATGCCTCCCTTATCTTCAGGGAAAAGGCCCTCTAGGAGGGTGTTGTCGTGGAGTTAAGGGTCTATTGGGCGCAGCCAAG
ACCCCCGCGGATCGAAAGACAGCATGCACTTGCCTCAAATCAGCTGCTAATGCTATTAAAGGCCTTAATCTAGGCAAAGCCGCTGGTATA
CCTAGTGCTTGTGGCGTAAGCATTCCTTACAAGATCAGCCCTTTTACTGCTGCTCGAAGGTTCAGTAAGGTTGATGAAAGTTCAATTTTC
CAAGGCATAATTGGGGAAAAATAA\
Edits in Original Sequence 
TCAAGCAAATACATTCCTAGTCCACAGAACTTCTCTATCTTTTCTCAAATTTTTGTAACAAATGGAA(5')ATGTCTAGCAAAATTGCAT
GCTTTATTGTTTTGTGCATGATAGTGGTTGCACCCCATGGAGAAGCACTAAGTTGCGGCCAGGTTGAATCTGGCTTAGCTCCATGCCTCC
CTTATCTTCAGGGAAAAGGCCCTCTAGGAGGGTGTTGTCGTGGAGTTAAGGGTCTATTGGGCGCAGCCAAGACCCCCGCGGATCGAAAGA
CAGCATGCACTTGCCTCAAATCAGCTGCTAATGCTATTAAAGGCCTTAATCTAGGCAAAGCCGCTGGTATACCTAGTGCTTGTGGCGTAA
GCATTCCTTACAAGATCAGCCCTTTTACTGaCTGCTCGAAGGTTCAGTAAGGTTGATGAAAGTTCAATTTTCCAAGGCATAATTGGGGAA
AAATAA\(3')GACGGATATATCTATCGATCGATCGAGTTTAATCCATCATTTTATAATATGTTGTCTCTTTTATTTTGTATTTTTGTTT
GTTGGAGTACTTATATGTTGTCGAGTATTGTAATGAACTTTGGTGGTTGGTTGTATTACAACCCAATCTTCATAGTAATATATATACATC
ATATTTTACTTTTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan