ESTScan Details for Unigene SGN-U216427

Score 
1344
Direction 
Forward
Predicted Peptide Sequence 
MAPAADVEDEIKDEKNPRPLDEDDIALLKTYGLGPYSTSIKKCEKEIKEMAKKINDLCGIKESDTGLAVPSQWDLVSDKQMMQEEQPLQV
ARCTKIISPNTEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIE
KMREVVELPMLHPEKFVKLGIDPPKGVLCYGPPGTGKTLLARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFQMARSKKACIVFFD
EVDAIGGARFDDGVGGDNEVQRTMLEIVNQLDGFDARGNIKVLMATNRPDTLDPALLRPGRLDRKVEFGLPDLESRTQIFKIHTRTMNCG
GTFGLNSWPDSXPNSTGADIRSVCTEAGMYAIRARRKTVTEKDFLDAVNKVIKGYQKFSATPSTWSTIDWASFWLLMEGTKGIDXEQGAF
FDHEKCLGYGLEDAGSDVTCAF
Predicted Coding Sequence 
ATGGCACCGGCAGCAGATGTGGAGGATGAGATTAAGGACGAGAAGAACCCTAGGCCTCTTGATGAAGATGATATTGCTCTACTCAAGACT
TATGGTTTGGGGCCTTATTCCACAAGCATAAAGAAATGTGAGAAGGAAATCAAGGAAATGGCAAAAAAAATAAATGATTTGTGTGGTATT
AAGGAATCTGACACTGGGTTGGCTGTACCAAGTCAGTGGGATCTAGTTTCAGATAAACAGATGATGCAGGAGGAGCAACCTCTTCAGGTG
GCTAGGTGTACAAAGATAATTAGCCCCAATACTGAAGATGCAAAATATGTTATAAATGTCAAGCAAATTGCTAAGTTTGTTGTTGGATTA
GGTGATAAAGTTTCACCGACTGATATAGAAGAAGGCATGAGAGTTGGCGTTGATAGGAATAAATATCAAATTCAGATTCCGTTGCCCCCC
AAAATTGATCCAAGTGTCACAATGATGACTGTCGAGGAAAAACCTGATGTTACATATAATGATGTTGGAGGATGCAAGGAACAAATCGAG
AAGATGCGAGAGGTTGTTGAACTTCCCATGCTTCACCCTGAAAAATTTGTCAAACTTGGAATTGACCCCCCTAAGGGTGTTCTCTGCTAT
GGTCCTCCTGGTACTGGGAAAACATTGCTTGCCAGAGCTGTTGCAAATCGTACGGATGCATGCTTCATTCGTGTTATTGGTAGTGAGCTT
GTTCAGAAATATGTTGGTGAGGGCGCTAGAATGGTTCGCGAACTGTTCCAGATGGCACGCTCCAAGAAGGCCTGCATTGTGTTTTTCGAC
GAAGTAGATGCCATTGGAGGTGCACGATTTGATGATGGAGTTGGGGGAGACAATGAGGTTCAAAGAACCATGCTTGAAATTGTGAACCAG
CTTGATGGTTTTGATGCTCGAGGGAATATTAAAGTTCTCATGGCAACCAATAGACCTGATACACTTGATCCAGCTTTATTACGTCCTGGA
CGATTGGATCGGAAAGTTGAATTTGGGCTGCCTGATTTGGAGAGTAGAACACAGATATTTAAGATTCACACACGGACAATGAACTGCGGC
GGGACATTCGGTTTGAACTCTTGGCCCGACTCTGXTCCTAACTCTACAGGAGCTGACATTAGAAGTGTGTGCACGGAAGCTGGAATGTAT
GCTATTCGGGCGAGGAGGAAAACTGTCACGGAGAAAGACTTTTTAGATGCTGTGAATAAAGTCATCAAAGGGTATCAGAAGTTCAGTGCA
ACACCAAGTACATGGTCTACAATTGATTGGGCCTCTTTTTGGCTTTTGATGGAGGGGACAAAAGGCATTGACAXGGAACAAGGAGCTTTC
TTTGATCATGAAAAATGTCTTGGTTACGGCCTGGAAGATGCAGGATCAGATGTGACTTGTGCATTTTAA\
Edits in Original Sequence 
AAAACTAAAAGATTCCAATCTGAAGGCA(5')ATGGCACCGGCAGCAGATGTGGAGGATGAGATTAAGGACGAGAAGAACCCTAGGCCTC
TTGATGAAGATGATATTGCTCTACTCAAGACTTATGGTTTGGGGCCTTATTCCACAAGCATAAAGAAATGTGAGAAGGAAATCAAGGAAA
TGGCAAAAAAAATAAATGATTTGTGTGGTATTAAGGAATCTGACACTGGGTTGGCTGTACCAAGTCAGTGGGATCTAGTTTCAGATAAAC
AGATGATGCAGGAGGAGCAACCTCTTCAGGTGGCTAGGTGTACAAAGATAATTAGCCCCAATACTGAAGATGCAAAATATGTTATAAATG
TCAAGCAAATTGCTAAGTTTGTTGTTGGATTAGGTGATAAAGTTTCACCGACTGATATAGAAGAAGGCATGAGAGTTGGCGTTGATAGGA
ATAAATATCAAATTCAGATTCCGTTGCCCCCCAAAATTGATCCAAGTGTCACAATGATGACTGTCGAGGAAAAACCTGATGTTACATATA
ATGATGTTGGAGGATGCAAGGAACAAATCGAGAAGATGCGAGAGGTTGTTGAACTTCCCATGCTTCACCCTGAAAAATTTGTCAAACTTG
GAATTGACCCCCCTAAGGGTGTTCTCTGCTATGGTCCTCCTGGTACTGGGAAAACATTGCTTGCCAGAGCTGTTGCAAATCGTACGGATG
CATGCTTCATTCGTGTTATTGGTAGTGAGCTTGTTCAGAAATATGTTGGTGAGGGCGCTAGAATGGTTCGCGAACTGTTCCAGATGGCAC
GCTCCAAGAAGGCCTGCATTGTGTTTTTCGACGAAGTAGATGCCATTGGAGGTGCACGATTTGATGATGGAGTTGGGGGAGACAATGAGG
TTCAAAGAACCATGCTTGAAATTGTGAACCAGCTTGATGGTTTTGATGCTCGAGGGAATATTAAAGTTCTCATGGCAACCAATAGACCTG
ATACACTTGATCCAGCTTTATTACGTCCTGGACGATTGGATCGGAAAGTTGAATTTGGGCTGCCTGATTTGGAGAGTAGAACACAGATAT
TTAAGATTCACACACGGACAATGAACTGCGaGCGGGACATTCGGTTTGAACTCTTGGCCCGACTCTGXTCCTAACTCTACAGGAGCTGAC
ATTAGAAGTGTGTGCACGGAAGCTGGAATGTATGCTATTCGGGCGAGGAGGAAAACTGTCACGGAGAAAGACTTTTTAGATGCTGTGAAT
AAAGTCATCAAAGGGTATCAGAAGTTCAGTGCAACACCgAAGTACATGGTCTACAATTGATTGGGCCTCTTTTTGGCTTTTGATGGAGGG
GACAAAAGGCATTGACAXGGAACAAGGAGCTTTCTTTGATCATGAAAAATGTCTTGGTTACGGCCTGGAAGATGCAGGATCAGATGTGAC
TTGTGCATTTTAA\(3')AACCTTTGATGATTGTTGTCGGTACCAAAAGAGAACTCTATTTCTCTGATAGTTTTCTATGTTTCAGCTTCT
TTAGTTGTACTTCCATTCATAGCTTTGCAATGTTTTTGTTTTGACTGCCCACTGTTACACATCTTCAAAGAGATACATTTGTTTTTTGTT
CTGCAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan