ESTScan Details for Unigene SGN-U216507

Score 
678
Direction 
Forward
Predicted Peptide Sequence 
DIHFHFTKATHTDTLNLQRTELPSLLRLKRSISKPSSGRIVEALEKDEFWQVHQVQGLFXIAVTIGQGKGATSXIVEGKEVEETVGEEVF
GDLXASFEKQNLGVYENKEKCLIFNIIILLKGSVYXAALGEVYNFVKNGVFMEVSVFAEPAPIALILTAIAVSFASAFRALNYGKEMERN
RDWSEASITLDRSQAXYDPGSELLQLAYDVLFVLFSLKILTVFTAVASASSLYFCLFPYIAQIKSRFGLADPFVSAVVEAIYQDPRPFDV
AVHWHGYSVASLWALDTDNLLGISLCIAFVSHVRLPNIKVCAMLLGCLFVYDIFWVFYSERFFGANVMVSVATQQSSNPVHIVANRLSLP
GLQLITKKLELPVKIVFPRNLLGGVVPGYAAVDFMMLGLGDMAIPSMLLALVLCFDHRKSKDSGSIMDIPPPKEDISSPKGFYIWYALAG
YSVGLVTALAAGXFDSLATTSTSILGTINFGADNCHFMDEKGAAELWEGSPSNINEKTRFTEAELLHSSHKAX
Predicted Coding Sequence 
GATATTCACTTTCATTTCACTAAAGCAACTCACACTGATACACTGAATCTCCAGAGAACAGAATTGCCTTCTCTTCTCCGGTTGAAACGT
TCGATAAGCAAACCCTCATCAGGCCGGATCGTTGAGGCGTTGGAGAAAGACGAGTTCTGGCAAGTTCATCAAGTCCAAGGTTTATTTGAX
ATTGCGGTGACGATTGGTCAAGGTAAAGGAGCAACTTCTXATATAGTGGAAGGGAAGGAAGTAGAGGAAACAGTAGGTGAAGAGGTGTTT
GGAGACCTTAXAGCATCTTTTGAAAAGCAAAATCTGGGAGTTTATGAAAATAAGGAGAAGTGTTTGATTTTTAACATTATTATACTTCTG
AAAGGAAGTGTTTATAXGGCAGCACTAGGAGAAGTGTACAACTTTGTTAAGAATGGAGTCTTTATGGAAGTTAGTGTATTTGCTGAACCA
GCACCCATCGCTCTTATTCTGACTGCCATAGCTGTGTCATTTGCATCTGCCTTCCGGGCTTTAAATTATGGCAAAGAAATGGAGAGAAAT
CGTGATTGGTCTGAAGCATCAATTACCTTAGACAGGTCTCAGGCTXCTTATGATCCCGGTAGTGAGCTCTTGCAGCTTGCTTATGATGTT
CTATTTGTTCTCTTCAGTCTCAAGATCCTCACTGTGTTCACTGCAGTTGCCTCAGCATCTTCTCTTTACTTTTGCCTTTTCCCTTATATT
GCCCAAATCAAGTCTCGATTTGGCTTAGCTGATCCCTTCGTATCTGCTGTTGTTGAAGCCATTTACCAGGATCCAAGGCCTTTTGACGTT
GCTGTGCATTGGCACGGTTATAGCGTGGCTTCTCTCTGGGCATTGGATACTGATAATTTGCTGGGCATCTCTCTTTGTATTGCGTTTGTG
AGCCATGTTCGCCTTCCTAACATTAAGGTTTGTGCAATGCTCCTTGGCTGCTTGTTTGTATATGATATATTCTGGGTTTTCTATTCCGAG
AGATTCTTTGGTGCAAATGTCATGGTGTCTGTAGCAACCCAGCAATCATCGAATCCTGTACACATAGTGGCGAATAGATTGAGCCTTCCT
GGATTGCAGTTGATAACCAAAAAACTCGAGTTGCCTGTCAAGATTGTGTTCCCTAGAAACTTACTGGGTGGTGTAGTGCCTGGATATGCT
GCTGTTGATTTCATGATGCTGGGTCTTGGCGACATGGCTATTCCTTCTATGCTTTTAGCATTGGTTCTCTGTTTTGACCATAGAAAGAGC
AAGGACTCTGGAAGCATCATGGATATACCACCTCCAAAGGAGGATATATCATCTCCAAAGGGGTTTTACATCTGGTATGCGCTAGCAGGA
TATTCCGTTGGACTGGTTACTGCCTTAGCAGCTGGTXATTTTGACTCACTCGCCACAACCAGCACTTCTATACTTGGTACCATCAACTTT
GGGGCCGATAATTGTCATTTCATGGATGAGAAAGGAGCTGCTGAGCTGTGGGAAGGATCACCGTCAAACATAAATGAGAAAACTCGTTTT
ACTGAAGCTGAGCTCTTGCATTCTTCCCATAAAGCTAXX\
Edits in Original Sequence 
(5')GATATTCACTTTCATTTCACTAAAGCAACTCACACTGATACACTGAATCTCCAGAGAACAGAATTGCCTTCTCTTCTCCGGTTGAA
ACGTTCGATAAGCAAACCCTCATCAGGCCGGATCGTTGAGGCGTTGGAGAAAGACGAGTTCTGGCAAGTTCATCAAGTCCAAGGTTTATT
TGAXATTGCGGTGACGATTGGTCAAGGTAAAGGAGCAACTTCTXATATAGTGGAAGGGAAGGAAGTAGAGGAAACAGTAGGTGAAcGAGG
TGTTTGGAGACCTTAXAGCATCTTTTGAAAAGCAAAATCTGGGAGTTTATGAAAATAAGGAGAAGTGTTTGATTTTTAACATTATTATAC
TTCTGAAAGGAAGTGTTTATAXGGCAGCACTAGGAGAAGTGTACAACTTTGTTAAGAATGGAGTCTTTATGGAAGTTAGTGTATTTGCtT
GAACCAGCACCCATCGCTCTTATTCTGACTGCCATAGCTGTGTCATTTGCATCTGCCTTCCGGGCTTTAAATTATGGCAAAGAAATGGAG
AGAAATCGTGATTGGTCTGAAGCATCAATTACCTTAGACAGGTCTCAGGCTXCTTATGATCCCGGTAGTGAGCTCTTGCAGCTTGCTTAT
GATGTTCTATTTGTTCTCTTCAGTCTCAcAGATCCTCACTGTGTTCACTGCAGTTGCCTCAGCATCTTCTCTTTACTTTTGCCTTTTCCC
TTATATTGCCCAAATCAAGTCTCGATTTGGCTTAGCTGATCCCTTCGTATCTcGCTGTTGTTcGAAGCCATTTACCAGGATCCAAGGCCT
TTTGACGTTGCTGTGCATTGGCACGGTTATAGCGTGGCTTCTCTCTGGGCATTGGATACTGaATAATTTGCTGGGCATCTCTCTTTGTAT
TGCGTTTGTGAGCCATGTTCGCCTTCCTAACATTAAGGTTTGTGCAATGCTCCTTGGCTGCTTGTTTGTATATGATATATTCTGGGTTTT
CTATTCCGAGAGATTCTTTGGTGCAAATGTCATGGTGTCTGTAGCAACCCAGCAATCATCGAATCCTGTACACATAGTGGCGAATAGATT
GAGCCTTCCTGGATTGCAGTTGATAACCAAAAAACTCGAGTTGCCTGTCAAGATTGTGTTCCCTAGAAACTTACTGGGTGGTGTAGTGCC
TGGATATGCTGCTGTTGATTTCATGATGCTGGGTCTTGGCGACATGGCTATTCCTTCTATGCTTTTAGCATTGGTTCTCTGTTTTGACCA
TAGAAAGAGCAAGGACTCTGGAAGCATCATGGATATACCACCTCCAAAGGAGGATATATCATCTCCAAAGGGGTTTTACATCTGGTATGC
GCTAGCAGGATATTCCGTTGGACTGGTTACTGCCTTAGCAGCTGGTXATTTTGACTCACTCGCCACAACCAGCACTTCTATACTTGGTAC
CATCAACTTTGGGGCCGATAATTGTCATTTCATGGATGAGAAAGGAGCTaGCTGAGCTGTGGGAAGGATCACCGTCAAACATAAATGAGA
AAACTCGTTTTACTGAAGtCTGAGCTCTTGCATTCTTCCCATAAAGCTAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan