ESTScan Details for Unigene SGN-U216518

Score 
404
Direction 
Forward
Predicted Peptide Sequence 
MNIFRLAGDMTHLASVLVLLLKIHTIKSCAGVSLKTQELYALVFVTRYLDIFTDFISLYNTTMKLVFLGSSLSIVWYMRHHKIVRRSYDK
DQDTFRHVLLVVPCLVLALVIHEKFTFKEVMWTFSIFLEAVAILPQLVLLQRTRNIDNLTGQYILLLGAYRSLYILNWVYRYFTEPXLCT
LDXPGLQASFRRCFMLISSIITSKAGRITPNSNFLPELXIEVNKSWLKNDPDERXIGQGYSLPRPRGWVFLLLLAITRAREEKHDTNHI
Predicted Coding Sequence 
ATGAATATATTCAGGCTTGCTGGGGATATGACCCATTTGGCTAGTGTTCTTGTTTTGCTTCTCAAGATCCATACTATTAAATCTTGTGCT
GGTGTTTCTCTGAAGACGCAAGAGCTATATGCTCTTGTCTTTGTTACTCGCTACTTGGACATATTTACAGACTTTATTTCACTATACAAT
ACTACAATGAAGTTGGTTTTCTTGGGAAGCTCTTTGTCAATTGTGTGGTACATGAGGCATCACAAAATTGTTCGGAGATCTTATGACAAA
GACCAAGATACTTTCCGTCATGTTCTCCTTGTGGTTCCTTGCCTTGTATTGGCTCTTGTTATACATGAAAAGTTTACCTTCAAGGAGGTA
ATGTGGACCTTCTCCATATTCTTGGAAGCTGTCGCTATCCTTCCTCAGCTTGTCTTGTTGCAGAGAACAAGAAACATAGACAATTTGACT
GGACAATACATTTTACTCTTGGGCGCATATCGGTCACTTTACATCTTGAACTGGGTATACCGCTACTTCACAGAACCAXCACTTTGTACA
TTGGATAXACCTGGATTGCAGGCCTCATTCAGACGTTGCTTTATGCTGATTTCTTCTATTATTACTTCCAAAGCTGGAAGAATAACACCA
AACTCGAACTTCCTGCCTGAGCTCATXATAGAAGTAAACAAGAGCTGGCTGAAGAATGATCCCGATGAACGTXTTATAGGCCAGGGTTAT
TCTCTGCCCCGTCCCCGCGGCTGGGTTTTCCTTCTTTTGTTGGCTATAACTAGGGCAAGAGAAGAAAAACATGATACGAATCATATTTAG
\
Edits in Original Sequence 
TGGTGGCAGTGTGTGTGTGAGAAGTTGCCAAGATCTGTGATTTTTCTGAGTAGATCTGTTGGTGGGGTTTGTTGAAAAAGATTCAATTTT
GATCTTGTTTAGAGAAAAG
(5')ATGAATATATTCAGGCTTGCTGGGGATATGACCCATTTGGCTAGTGTTCTTGTTTTGCTTCTCAAGA
TCCATACTATTAAATCTTGTGCTGGTGTTTCTCTGAAGACGCAAGAGCTATATGCTCTTGTCTTTGTTACTCGCTACTTGGACATATTTA
CAGACTTTATTTCACTATACAATACTACAATGAAGTTGGTTTTCTTGGGAAGCTCTTTGTCAATTGTGTGGTACATGAGGCATCACAAAA
TTGTTCGGAGATCTTATGACAAAGACCAAGATACTTTCCGTCATGTTCTCCTTGTGGTTCCTTGCCTTGTATTGGCTCTTGTTATACATG
AAAAGTTTACCTTCAAGGAGGTAATGTGGACCTTCTCCATATTCTTGGAAGCTGTCGCTATCCTTCCTCAGCTTGTCTTGTTGCAGAGAA
CAAGAAACATAGACAATTTGACTGGACAATACATTTTACTCTTGGGCGCATATCGGTCACTTTACATCTTGAACTGGGTATACCGCTACT
TCACAGAACCAXCACTTTGTACATTGGATAXACCTGGATTGCAGGCCTCATTCAGACGTTGCTTTATGCTGATTTCTTCTATTATTACTT
CCAAAGCTGGAAGAATAACACCAAACTCGAACTTCCTGCCTGAGCTCATXATAGAAGTAAACAAGAGCTGGCTGAAGAATGATCCCGATG
AACGTXTTATAGGCCAGGGTTATTCTCTGCCCCGTCCCCGCGGCTGGGTTTTCCTTCTTTTGTTGGCTATAACTAGGGCAAGAGtAAGAA
AAACATGATACGAATCATATTTAG\(3')AGTCTTGTTTGCATCAAGAATTCATGTCTTTGCTGCTAAGTAGATTGTTAAAATGCATATT
CTTTATGTATCAAGAAAACTTTGTGACTTCATTTTTGTTGTACTAGAGAGATTTTTGTTTCTTGGACTTCATAATTAGTTCAAGAAAAAA
AAGAGAGAAAATGATCACAACTTCTCTTTTTAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan