ESTScan Details for Unigene SGN-U216571

Score 
1529
Direction 
Forward
Predicted Peptide Sequence 
NIRCFQSEGRHRSRDYFTNYQQRVAGNLVPMACYAAIEKGGDVFFPTPARSSSSVFSLAHVRAYIYFVAKXATAFLHTHQDTGILAAATP
LXWKEGSWVPEIPVYVPERPNIFQFVNXGFKMLDSCFLNKNKMLEIEKGANDFNIPIIRSNRKLVASTDGGLHKPSCLVFNSAWKARQVE
HEPNKKLNYPSPAGIQRPKSDEDIAFMSILELGQLLKENLITSVELTGIFLKRLKRYGPVLESVVTITEELAYKQAKEADQLLAEGKYLG
PLHGIPYGLKDIIAVPNYTTTWGSTSFKDQVLDIEAWVYKRLKSAGAVLVAKLVTGSLAYDDIWFGGRTRNPWNIEEYSTGSSAGPASCT
SAGLVPFAIGSETCGSITYPASRCGVTALRPTFGAVGRTGIMSIAESLDKIGPFCRNSVDCVIILDAIRGKDPDDVSSRDISFRDPFSVD
ITKLTVGYLEDAEMEVVHVLQSKGVNMVPFNLSYTVDSVQGVLNFTMDVEMLAHFDKWQRSNLDDEYEAQDQWPTELRRARAISAVDYFQ
AQRARGILIQQVRENFSVDAFIGNATDWEKVCVGNLVGIPVVIVPTGFKKISDAPSNDIRRRTTITTGIYAPPDRDHIALALAIAYQSVT
NHHKQRPPIDDLGPNDPIPESPKSLSGIECCSCSQVLDMNLHALEPGGFRPPFVAAKTMEV
Predicted Coding Sequence 
XCGAATATTCGATGCTTTCAATCGGAAGGAAGGCATCGATCCAGAGATTACTTTACAAACTATCAACAGAGGGTTGCCGGAAATCTAGTA
CCCATGGCTTGTTACGCGGCGATTGAAAAGGGCGGCGACGTGTTTTTCCCAACTCCGGCACGTTCXAGTTCGTCGGTCTTTTCACTTGCT
CATGTTCGTGCTTATATTTACTTTGTTGCTAAAXTAGCAACTGCGTTTCTTCATACTCATCAGGATACTGGGATTTTAGCAGCAGCAACT
CCACTGTGATGGAAAGAGGGAAGTTGGGTCCCGGAAATCCCGGTGTATGTTCCAGAAAGGCCAAACATCTTCCAGTTTGTGAATGXTGGA
TTCAAAATGTTGGACTCTTGCTTCTTGAATAAGAACAAGATGCTTGAAATAGAAAAGGGAGCAAATGACTTTAACATACCCATAATCAGA
TCCAACCGAAAATTAGTTGCCTCTACTGATGGAGGTCTGCATAAACCGTCTTGTTTAGTCTTCAATTCTGCATGGAAGGCCCGACAAGTA
GAACACGAACCAAACAAAAAGCTCAATTATCCATCACCTGCTGGTATACAAAGACCAAAAAGTGATGAGGATATCGCATTCATGAGTATT
CTTGAACTTGGCCAGCTTCTCAAGGAAAATTTAATCACATCAGTGGAGCTGACTGGAATTTTCTTGAAGAGACTGAAGAGGTATGGTCCT
GTTCTTGAATCGGTCGTTACAATTACTGAAGAATTAGCATACAAACAAGCAAAAGAGGCTGATCAACTTCTTGCTGAAGGCAAATATTTG
GGTCCTCTTCATGGGATTCCTTATGGTCTGAAGGACATCATAGCAGTACCTAACTATACCACAACATGGGGTTCAACATCTTTTAAAGAC
CAAGTTCTTGATATTGAAGCTTGGGTTTATAAAAGGCTGAAATCTGCCGGGGCAGTTCTTGTTGCAAAGTTAGTAACTGGTTCTTTAGCA
TATGATGATATCTGGTTTGGTGGTAGAACAAGAAACCCGTGGAATATCGAGGAATATTCTACGGGATCATCAGCAGGTCCTGCTTCTTGC
ACCTCAGCAGGTTTGGTTCCATTTGCAATTGGTTCAGAAACTTGCGGCTCTATTACCTATCCAGCTTCCCGCTGTGGCGTGACGGCACTG
CGGCCCACTTTTGGAGCTGTTGGTCGAACGGGTATTATGAGCATAGCTGAAAGCTTGGATAAAATAGGCCCTTTTTGTAGAAACTCTGTG
GATTGTGTGATTATTCTGGATGCCATTCGGGGAAAGGACCCAGATGATGTTTCATCTAGAGACATATCCTTTAGAGATCCATTCTCAGTT
GATATCACAAAGCTCACTGTTGGATATCTTGAGGATGCTGAGATGGAAGTCGTTCACGTACTCCAATCAAAAGGAGTGAATATGGTCCCG
TTTAACCTGAGTTACACTGTTGATTCCGTCCAAGGTGTCCTCAATTTCACAATGGATGTTGAGATGCTGGCTCACTTTGACAAATGGCAG
CGCTCAAATCTGGATGATGAATATGAAGCCCAAGATCAATGGCCTACTGAACTTCGCCGAGCACGTGCCATATCTGCAGTTGACTATTTT
CAGGCACAAAGAGCTAGAGGTATATTGATTCAGCAAGTAAGAGAAAATTTCAGCGTTGATGCATTTATTGGAAATGCAACTGACTGGGAG
AAAGTTTGTGTTGGCAATCTTGTGGGTATTCCAGTAGTAATTGTTCCAACAGGATTCAAAAAGATATCTGATGCACCATCAAATGATATT
CGCCGAAGAACAACAATAACTACAGGCATATATGCTCCTCCGGACCGTGATCATATCGCCTTAGCTTTAGCAATTGCTTATCAATCAGTT
ACCAATCATCATAAGCAGCGGCCACCAATTGATGACCTTGGTCCAAATGATCCTATTCCAGAATCACCAAAATCCCTTAGTGGTATTGAA
TGTTGTTCATGCTCACAAGTGCTTGATATGAACCTCCATGCGCTTGAGCCTGGTGGATTCAGACCACCGTTTGTAGCTGCTAAAACTATG
GAAGTATGA\
Edits in Original Sequence 
(5')XCGAATATTCGATGCTTTCAATCGGAAGGAAGGCATCGATCCAGAGATTACTTTACAAACTATCAACAGAGGGTTGCCGGAAATCT
AGTACCCATGGCTTGTTACGCGGCGATTGAAAAGGGCGGCGACGTGTTTTTCCCAACTCCGGCACGTTCXAGTTCGTCGGTCTTTTCACT
TGCTCATGTTCGTGCTTATATTTACTTTGTTGCTAAAXTAGCAACTGCGTTTCTTCATACTCATCAGGATACTGGGATTTTAGCAGCAGC
AACTCCACTGTGATGGAAAGAGGGAAGTTGGGTCCCGGAAATCCCGGTGTATGTTCCAGAAAGGCCAAACATCTTCCAGTTTGTGAATGX
TGGATTCAAAATGTTGGACTCTTGCTTCTTGAATAAGAACAAGATGCTTGAAATAGAAAAGGGAGCAAATGACTTTAACATACCCATAAT
CAGATCCAACCGAAAATTAGTTGCCTCTACTGATGGAGGTCTGCATAAACCGTCTTGTTTAGTCTTCAATTCTGCATGGAAGGCCCGACA
AGTAGAACACGAACCAAACAAAAAGCTCAATTATCCATCACCTGCTGGTATACAAAGACCAAAAAGTGATGAGGATATCGCATTCATGAG
TATTCTTGAACTTGGCCAGCTTCTCAAGGAAAATTTAATCACATCAGTGGAGCTGACTGGAATTTTCTTGAAGAGACTGAAGAGGTATGG
TCCTGTTCTTGAATCGGTCGTTACAATTACTGAAGAATTAGCATACAAACAAGCAAAAGAGGCTGATCAACTTCTTGCTGAAGGCAAATA
TTTGGGTCCTCTTCATGGGATTCCTTATGGTCTGAAGGACATCATAGCAGTACCTAACTATACCACAACATGGGGTTCAACATCTTTTAA
AGACCAAGTTCTTGATATTGAAGCTTGGGTTTATAAAAGGCTGAAATCTGCCGGGGCAGTTCTTGTTGCAAAGTTAGTAACTGGTTCTTT
AGCATATGATGATATCTGGTTTGGTGGTAGAACAAGAAACCCGTGGAATATCGAGGAATATTCTACGGGATCATCAGCAGGTCCTGCTTC
TTGCACCTCAGCAGGTTTGGTTCCATTTGCAATTGGTTCAGAAACTTGCGGCTCTATTACCTATCCAGCTTCCCGCTGTGGCGTGACGGC
ACTGCGGCCCACTTTTGGAGCTGTTGGTCGAACGGGTATTATGAGCATAGCTGAAAGCTTGGATAAAATAGGCCCTTTTTGTAGAAACTC
TGTGGATTGTGTGATTATTCTGGATGCCATTCGGGGAAAGGACCCAGATGATGTTTCATCTAGAGACATATCCTTTAGAGATCCATTCTC
AGTTGATATCACAAAGCTCACTGTTGGATATCTTGAGGATGCTGAGATGGAAGTCGTTCACGTACTCCAATCAAAAGGAGTGAATATGGT
CCCGTTTAACCTGAGTTACACTGTTGATTCCGTCCAAGGTGTCCTCAATTTCACAATGGATGTTGAGATGCTGGCTCACTTTGACAAATG
GCAGCGCTCAAATCTGGATGATGAATATGAAGCCCAAGATCAATGGCCTACTGAACTTCGCCGAGCACGTGCCATATCTGCAGTTGACTA
TTTTCAGGCACAAAGAGCTAGAGGTATATTGATTCAGCAAGTAAGAGAAAATTTCAGCGTTGATGCATTTATTGGAAATGCAACTGACTG
GGAGAAAGTTTGTGTTGGCAATCTTGTGGGTATTCCAGTAGTAATTGTTCCAACAGGATTCAAAAAGATATCTGATGCACCATCAAATGA
TATTCGCCGAAGAACAACAATAACTACAGGCATATATGCTCCTCCGGACCGTGATCATATCGCCTTAGCTTTAGCAATTGCTTATCAATC
AGTTACCAATCATCATAAGCAGCGGCCACCAATTGATGACCTTGGTCCAAATGATCCTATTCCAGAATCACCAAAATCCCTgTAGTGGTA
TTGAATGTTGTTCATGCTCACAAGTGCTTGATATGAACCTCCATGCGCTTGAGCCTGGTGtGATTCAGACCACCGTTTGTAGCTGCTAAA
ACTATGGAAGTATGA\(3')ATCTCAGCTTTCTGTTCGGGCCATGAGAAAACTAAAATTCTGTTTACTTCTGTCACTGTTTTATAGTTCT
AATTCTGTGAAATTTCTTATTACTTTTGATCTGTAAATGATTTAACTTTGTATTAAGTGGATTATTTATCCAATAAGAAGAGTAACACTT
CTACTGAGAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan