ESTScan Details for Unigene SGN-U216624

Score 
879
Direction 
Forward
Predicted Peptide Sequence 
TPTIGDGAKNSDPLVRATVTIVLSLLVQPSFSIYCDEDDCYDLLGVTQNANSSEIKKAYYKLSLKHHPDKNPDPESKKLFVKIANAYEIL
KNEATREQYDYALAHPEEFFYNTARYYHAYYGHKTDTRAVLVGLLLIVSIFQYLNQWTRYNQAIDMVKKTPAYKNKLRALELQRTGGMTN
RKKGNKPMDKKVEEELGKELNLDIKGTEKPSVWELIGIRFILLPYTLGKLLLWYGCWFWRYNVKHAPYSWEDASYLTRRSLRASLDSWIS
IDESTKEDLIERRLWEKSNFESYVAEMRKESKPEDKKFLVLLKAMCRMRTVLMGEYSET
Predicted Coding Sequence 
XXAACGCCGACGATCGGAGATGGCGCGAAGAATAGCGATCCACTGGTTCGCGCCACAGTTACTATCGTGCTCTCCCTTCTTGTTCAGCCT
TCTTTCTCCATATACTGTGACGAAGATGACTGTTACGATCTCCTTGGGGTCACTCAAAATGCCAATTCTTCTGAAATCAAGAAAGCTTAT
TACAAGCTCTCTCTAAAACATCATCCAGATAAAAACCCTGATCCAGAATCAAAGAAGCTTTTTGTGAAAATTGCAAATGCTTATGAGATT
TTGAAAAACGAAGCCACAAGGGAGCAGTATGATTATGCACTTGCCCATCCAGAGGAGTTTTTCTACAATACAGCACGGTATTACCATGCT
TACTATGGTCACAAAACGGATACCCGTGCTGTCCTCGTTGGTCTTCTTTTGATAGTCTCAATATTTCAGTATCTGAATCAGTGGACAAGA
TATAATCAGGCTATTGACATGGTCAAGAAAACACCAGCTTATAAAAACAAGCTACGTGCTTTGGAGCTTCAACGCACTGGAGGAATGACT
AATAGGAAGAAGGGCAACAAGCCGATGGACAAGAAGGTGGAAGAAGAACTTGGCAAGGAACTCAACTTGGACATAAAGGGCACCGAAAAG
CCTTCTGTTTGGGAACTAATTGGAATCCGTTTTATACTTCTTCCTTACACTCTGGGAAAGCTGTTACTGTGGTATGGATGCTGGTTCTGG
AGGTACAATGTCAAGCATGCTCCATATTCATGGGAAGATGCCTCCTATTTGACACGAAGGTCACTTCGGGCTTCTCTTGATTCATGGATA
TCTATTGACGAATCAACCAAGGAAGATCTTATTGAAAGACGGCTTTGGGAGAAGTCCAACTTTGAAAGCTATGTGGCTGAGATGCGCAAG
GAATCAAAGCCCGAAGATAAAAAGTTTTTGGTTTTACTCAAAGCTATGTGTAGGATGAGAACAGTTTTGATGGGGGAGTATTCTGAGACA
TGA\
Edits in Original Sequence 
(5')XXAACGCCGACGATCGGAGATGGCGCGAAGAATAGCGATCCACTGGTTCGCGCtCACAGTTACTATCGTGCTCTCCCTTCTTGTTC
AGCCTTCTTTCTCCATATACTGTGACGAAGATGACTGTTACGATCTCCTTGGGGTCACTCAAAATGCCAATTCTTCTGAAATCAAGAAAG
CTTATTACAAGCTCTCTCTAAAACATCATCCAGATAAAAACCCTGATCCAGAATCAAAGAAGCTTTTTGTGAAAATTGCAAATGCTTATG
AGATTTTGAAAAACGAAGCCACAAGGGAGCAGTATGATTATGCACTTGCCCATCCAGAGGAGTTTTTCTACAATACAGCACGGTATTACC
ATGCTTACTATGGTCACAAAACGGATACCCGTGCTGTCCTCGTTGGTCTTCTTTTGATAGTCTCAATATTTCAGTATCTGAATCAGTGGA
CAAGATATAATCAGGCTATTGACATGGTCAAGAAAACACCAGCTTATAAAAACAAGCTACGTGCTTTGGAGCTTCAACGCACTGGAGGAA
TGACTAATAGGAAGAAGGGCAACAAGCCGATGGACAAGAAGGTGGAAGAAGAACTTGGCAAGGAACTCAACTTGGACATAAAGGGCACCG
AAAAGCCTTCTGTTTGGGAACTAATTGGAATCCGTTTTATACTTCTTCCTTACACTCTGGGAAAGCTGTTACTGTGGTATGGATGCTGGT
TCTGGAGGTACAATGTCAAGCATGCTCCATATTCATGGGAAGATGCCTCCTATTTGACACGAAGGTCACTTCGGGCTTCTCTTGATTCAT
GGATATCTATTGACGAATCAACCAAGGAAGATCTTATTGAAAGACGGCTTTGGGAGAAGTCCAACTTTGAAAGCTATGTGGCTGAGATGC
GCAAGGAATCAAAGCgCCGAAGATAAAAAGTTTTTGGTTTTACTCAAAGCTATGTGTAGGATGAGAACAGTTTTGATGGGGGAGTATTCT
GAGACATGA\(3')AGCAGGAAGTCTAATGTTTAAATTATTGAAGAAAGCAAAATTATTTTGACAAGGAGAGCTATTGAATTGATAAGTA
TGTCATAGAACTCGGATTTTCACGGTCAGTGTCATAGCTATATTAATAATACTATACAAAAAACATATTGAGACAGATACAAGCATATTG
CATTTGGAGCAATTTTGGGGGACGAGTGCTGCTCCCCACTTGCTGTTGTAATGCTAGGTTAGAATGTGTTGAAGCATCTATATGTTCTGA
AAAGACAGGAACTCTGTTCCATATAATGAACTTCATACTTGGCTATGTTGTATTTGTATGTACCATAGTCTTAACTGGTCAACTGTGAAA
AAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan