Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U216766

Score 
2063
Direction 
Forward
Predicted Peptide Sequence 
KSTISFPKTKVPDQLGESAKGKRKRRVKSALVDEAAVAGELRLRVRIPPNRDSRFRFDDPIGLNSKIREAELAGSEQPGASTRPEVIWPL
PKLRAFWQMASSGSSRADLKKMEDEFRAYEMSLMNPPSSIDDLFKILQKVESSLKMVSQEPFDSTISAIQPLMKALVRNELLGHTSEDVK
VSVISSVTEISRIYAPNRPYDDDRQMEEILRQTVMTFKKLADVTSRSYRKVVRVLELFAKVRFTAMILDLENETLIIEIFKIFLEVIRPY
HPHNIFTWMKEIMTRLIEGSDEISVELLQLLLDRVKIDNQMESPIASYLVEEVLKDCAAIVKPYFSDALKSMSFDPAHYAQTVALLSKEM
PKGKGMMATENVPATIIAVKVGPSEAKFCEPVRQDDTHREKLKDTCITNIMKPVNPEDVHPATNVPKENQEGTGSHKLTGHPVKVGPSEA
KFCEPVLQDDIHREKLKDTCTTNIMKPDNPEDVQPATNVPKENQEGTGSHELTDSSGHHSLVSENHNNSTGSHGHLCQSKRKEIPINNDD
ELVVSIPIGDVPQSQVQKKDSLHLGERTKRTQCAKRKLGSDSKKNESASDCETERKSESGIKNEEGNLEEHKEPTLQQIFGIKXVEEEDE
ETTNTEESRDKDSERARTSKDHGAELIGTKIKVWWPLEQAFYKGVIYSFDSETNKHKVVYDDGEVEKLRLHKERWEMLEDNSSQKDSKRL
CSIKDYGTELVGDRIKVWWPLDEKFYEGVISSFDFETNKHKVVYDDGEVEILRLYKQRWMMLEDNSSQKDFKRTFTMKDYGKELVGARIK
VWWPLDEKFYEGVVSSFDPVERKHKVVYDDGETEKLRLHKERWEMLEDNSTQKDHGLDFQVHAVSSATVIKQRRVEGPESVEISVVNREE
NSTAGSVEEFS
Predicted Coding Sequence 
XTGAAATCAACCATTTCCTTTCCCAAAACGAAAGTTCCAGATCAACTCGGAGAATCGGCTAAGGGAAAAAGAAAAAGGAGAGTGAAATCA
GCACTGGTTGATGAAGCTGCCGTTGCTGGTGAGCTCCGATTACGAGTTCGAATTCCACCTAACCGGGATAGTCGTTTCCGATTTGATGAT
CCGATAGGCCTGAACAGTAAGATCCGAGAAGCTGAATTGGCGGGTTCTGAACAACCTGGTGCTTCTACACGTCCXGAAGTGATCTGGCCC
CTACCTAAATTAAGAGCTTTTTGGCAAATGGCTAGTTCTGGCTCCTCCCGTGCTGACTTGAAAAAGATGGAAGATGAGTTCAGAGCTTAC
GAGATGAGCCTCATGAATCCTCCCTCTTCCATCGATGACCTCTTCAAAATTCTTCAGAAAGTTGAGTCATCACTGAAAATGGTTAGTCAA
GAACCATTTGATTCGACAATAAGTGCAATTCAACCTTTAATGAAAGCACTGGTTAGGAATGAACTATTGGGGCATACAAGTGAAGATGTC
AAAGTTTCAGTGATTTCTTCTGTCACTGAAATTTCTCGAATATATGCCCCAAATCGCCCTTACGATGATGATAGACAAATGGAGGAAATT
CTCCGGCAAACCGTAATGACTTTCAAAAAGTTAGCTGATGTGACTAGCCGCAGCTATCGTAAGGTGGTTCGAGTTCTGGAGTTATTCGCT
AAAGTAAGGTTCACTGCGATGATATTGGACCTCGAGAATGAAACGCTAATCATCGAGATATTCAAAATTTTTCTCGAGGTCATCAGGCCC
TACCATCCTCATAATATATTCACTTGGATGAAAGAAATCATGACTCGGCTCATAGAAGGCAGTGATGAAATCTCAGTAGAGCTTCTACAG
CTTCTTCTTGATAGAGTCAAAATTGATAATCAGATGGAATCACCCATCGCATCATACTTGGTGGAGGAAGTCCTAAAAGACTGTGCTGCA
ATTGTTAAACCATACTTTTCAGATGCCCTAAAATCAATGAGCTTTGATCCTGCTCATTATGCTCAAACGGTTGCTTTATTAAGCAAGGAA
ATGCCAAAAGGAAAAGGAATGATGGCAACTGAAAATGTGCCTGCTACTATCATTGCXGTAAAAGTTGGTCCATCTGAGGCTAAATTTTGT
GAGCCAGTGCGGCAGGATGACACTCACAGGGAGAAGCTAAAGGATACTTGTATAACAAACATCATGAAACCTGTCAATCCAGAAGATGTG
CACCCAGCAACAAATGTGCCAAAAGAAAACCAGGAAGGGACTGGAAGCCATAAACTTACAGGTCATCCTGTAAAAGTTGGTCCATCCGAG
GCTAAATTTTGTGAGCCAGTGCTGCAGGATGACATTCACAGGGAGAAGCTAAAAGATACTTGTACAACAAACATAATGAAACCTGACAAT
CCAGAAGATGTGCAACCAGCAACAAATGTGCCAAAAGAAAACCAGGAAGGGACTGGAAGTCATGAACTTACAGATAGTAGTGGCCATCAT
TCTTTGGTGTCTGAAAATCACAATAATAGCACTGGAAGTCATGGTCATCTGTGTCAGTCCAAGAGAAAAGAGATCCCGATAAATAACGAT
GATGAGCTGGTTGTGTCAATTCCAATAGGAGATGTGCCACAATCCCAAGTTCAGAAAAAAGATTCTCTTCATTTGGGAGAGAGAACCAAG
CGCACACAGTGTGCCAAAAGAAAACTAGGAAGCGACTCAAAGAAGAATGAGTCTGCTTCAGATTGTGAAACAGAGAGAAAATCTGAATCT
GGCATAAAAAATGAAGAAGGAAACCTCGAAGAACACAAAGAGCCAACACTGCAACAAATTTTTGGAATCAAAXCTGTGGAAGAAGAAGAC
GAAGAAACAACTAATACTGAAGAATCTAGAGATAAGGATTCTGAAAGGGCTCGTACCAGCAAAGATCATGGTGCAGAACTGATCGGCACT
AAAATAAAAGTTTGGTGGCCATTGGAGCAAGCGTTTTACAAGGGAGTCATTTATTCTTTTGATTCTGAGACAAACAAACACAAGGTCGTA
TATGATGATGGTGAAGTAGAGAAACTGAGACTTCATAAAGAACGATGGGAAATGCTTGAAGACAATTCATCTCAAAAGGATTCCAAAAGG
CTTTGTTCCATCAAAGATTATGGTACGGAACTGGTTGGCGATAGAATAAAAGTTTGGTGGCCATTGGATGAAAAGTTTTACGAGGGAGTC
ATTTCTTCTTTTGATTTTGAGACAAACAAACACAAGGTCGTATATGATGATGGTGAAGTAGAGATTTTGAGACTATATAAACAACGTTGG
ATGATGCTTGAAGACAATTCATCTCAAAAGGATTTTAAAAGGACTTTTACCATGAAAGATTATGGTAAGGAACTGGTTGGCGCTAGGATA
AAAGTTTGGTGGCCATTGGATGAAAAGTTTTACGAGGGAGTAGTTTCTTCTTTTGATCCTGTGGAAAGGAAACACAAGGTCGTATATGAT
GATGGTGAAACAGAGAAATTGAGGCTACATAAAGAACGATGGGAGATGCTTGAAGATAATTCAACTCAAAAGGACCATGGATTAGACTTT
CAAGTCCATGCTGTTTCATCTGCTACXGTCATAAAGCAGCGTAGAGTAGAAGGGCCTGAATCAGTGGAAATTTCTGTTGTGAATAGGGAA
GAAAACTCAACTGCTGGAAGTGTTGAAGAATTTTCATAA\
Edits in Original Sequence 
(5')XTGAAATCAACCATTTCCTTTCCCAAAACGAAAGTTCCAGATCAgACTCGGAGAATCGGCTAAGGGAAAAAGAAAAAGGAGAGTGA
AATCAGCACTGGTTGATGAAGCTGCCGTTGcCTGGTGAGCTCCGATTACGAGTTCGAATTCCgACCTAACCGGGATAGTCGTTTCCtGAT
TTGATGATCCGATAGGCCTGAACAGTAAGATCCGAGAAGCTGAATTGGCGGGTTCTGAACAACCTGGTGCTTCTACACGTCCXGAAGTGA
TCTGGCCCCTACCTAAATTAAGAGCTTTTTGGCAAATGGCTAGTTCTGGCTCCTCCCGTGCTGACTTGAAAAAGATGGAAGATGAGTTCA
GAGCTTACGAGATGAGCCTCATGAATCCTCCCTCTTCCATCGATGACCTCTTCAAAATTCTTCAGAAAGTTGAGTCATCACTGAAAATGG
TTAGTCAAGAACCATTTGATTCGACAATAAGTGCAATTCAACCTTTAATGAAAGCACTGGTTAGGAATGAACTATTGGGGCATACAAGTG
AAGATGTCAAAGTTTCAGTGATTTCTTCTGTCACTGAAATTTCTCGAATATATGCCCCAAATCGCCCTTACGATGATGATAGACAAATGG
AGGAAATTCTCCGGCAAACCGTAATGACTTTCAAAAAGTTAGCTGATGTGACTAGCCGCAGCTATCGTAAGGTGGTTCGAGTTCTGGAGT
TATTCGCTAAAGTAAGGTTCACTGCGATGATATTGGACCTCGAGAATGAAACGCTAATCATCGAGATATTCAAAATTTTTCTCGAGGTCA
TCAGGCCCTACCATCCTCATAATATATTCACTTGGATGAAAGAAATCATGACTCGGCTCATAGAAGGCAGTGATGAAATCTCAGTAGAGC
TTCTACAGCTTCTTCTTGATAGAGTCAAAATTGATAATCAGATGGAATCACCCATCGCATCATACTTGGTGGAGGAAGTCCTAAAAGACT
GTGCTGCAATTGTTAAACCATACTTTTCAGATGCCCTAAAATCAATGAGCTTTGATCCTGCTCATTATGCTCAAACGGTTGCTTTATTAA
GCAAGGAAATGCCAAAAGGAAAAGGAATGATGGCAACTGAAAATGTGCCTGCTACTATaCATTGCXGTAAAAGTTGGTCCATCTGAGGCT
AAATTTTGTGAGCCAGTGCGGCAGGATGACACTCACAGGGAGAAGCTAAAGGATACTTGTATAACAAACATCATGAAACCTGTCAATCCA
GAAGATGTGCACCCAGCAACAAATGTGCCAAAAGAAAACCAGGAAGGGACTGGAAGCCATAAACTTACAGGTCATCCTGTAAAAGTTGGT
CCATCCGAGGCTAAATTTTGTGAGCCAGTGCTGCAGGATGACATTCACAGGGAGAAGCTAAAAGATACTTGTACAACAAACATAATGAAA
CCTGACAATCCAGAAGATGTGCAACCAGCAACAAATGTGCCAAAAGAAAACCAGGAAGGGACTGGAAGTCATGAACTTACAGATAGTAGT
GGCCATCATTCTTTGGTGTCTGAAAATCACAATAATAGCACTGGAAGTCATGGTCATCTGTGTCAGTCCAAGAGAAAAGAGATCCCGATA
AATAACGATGATGAGCTGGTTGTGTCAATTCCAATAGGAGATGTGCCACAATCCCAAGTTCAGAAAAAAGATTCTCTTCATTTGGGAGAG
AGAACCAAGCGCACACAGTGTGCCAAAAGAAAACTAGGAAGCGACTCAAAGAAGAATGAGTCTGCTTCAGATTGTGAAACAGAGAGAAAA
TCTGAATCTGGCATAAAAAATGAAGAAGGAAACCTCGAAGAACACAAAGAGCCAACACTGCAACAAATTTTTGGAATCAAAXCTGTGGAA
GAAGAAGACGAAGAAACAACTAATACTGAAGAATCTAGAGATAAGGATTCTGAAAGGGCTCGTACCAGCAAAGATCATGGTGCAGAACTG
ATCGGCACTAAAATAAAAGTTTGGTGGCCATTGGAGCAAGCGTTTTACAAGGGAGTCATTTATTCTTTTGATTCTGAGACAAACAAACAC
AAGGTCGTATATGATGATGGTGAAGTAGAGAAACTGAGACTTCATAAAGAACGATGGGAAATGCTTGAAGACAATTCATCTCAAAAGGAT
TCCAAAAGGCTTTGTTCCATCAAAGATTATGGTACGGAACTGGTTGGCGATAGAATAAAAGTTTGGTGGCCATTGGATGAAAAGTTTTAC
GAGGGAGTCATTTCTTCTTTTGATTTTGAGACAAACAAACACAAGGTCGTATATGATGATGGTGAAGTAGAGATTTTGAGACTATATAAA
CAACGTTGGATGATGCTTGAAGACAATTCATCTCAAAAGGATTTTAAAAGGACTTTTACCATGAAAGATTATGGTAAGGAACTGGTTGGC
GCTAGGATAAAAGTTTGGTGGCCATTGGATGAAAAGTTTTACGAGGGAGTAGTTTCTTCTTTTGATCCTGTGGAAAGGAAACACAAGGTC
GTATATGATGATGGTGAAACAGAGAAATTGAGGCTACATAAAGAACGATGGGAGATGCTTGAAGATAATTCAACTCAAAAGGACCATGGA
TTAGACTTTCAAGTCCATGCTGTTTCATCTGCTACXGTCATAAAGCAGCGTAGAGTAGAAGGGCCTGAATCAGTGGAAATTTCTGTTGTG
AATAGGGAAGAAAACTCAACTGCTGGAAGTGTTGAAGAATTTTCATAA\(3')AGCAGTGTGATGTAAGTGTAACTACTAAATTAGGTTT
ACCATTAAGGGATGTGATCCAATTGATTGGAGAAATGAGATTCTAGTCTTAGAAAAAAAGAACTGAGCTTGTAGATTTATTGTATGTAGC
TACAGGCTGCTCTTGGTGTTTACAGATACTTGGCGTCTTATATGTATATATATGATTAAATTAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan