ESTScan Details for Unigene SGN-U216888

Score 
334
Direction 
Forward
Predicted Peptide Sequence 
KKKMYLRTPIDRVLFSPSNPQFSRTQKVSFRVNSKLNNNVIEISESKSFYELLGIQETVSLLEIKQAYKQLARKYHPDVSPPGRVEENTQ
RFIRVQEAYETLSDPKSRDMYDKHMSKGLHFAFSPRRKCQNDESMENTGEWKNRWHSQLSELKRRNSHKDSGNNMSWGAHMRRQRSETSL
Predicted Coding Sequence 
AAGAAAAAAATGTATCTAAGAACCCCAATAGATCGTGTCCTATTTTCCCCATCAAATCCCCAATTTTCAAGAACTCAAAAAGTGTCTTTT
AGAGTAAACTCAAAACTTAACAACAATGTGATAGAAATTAGTGAATCAAAAAGCTTTTATGAGCTTTTGGGTATTCAAGAAACTGTTTCT
TTATTAGAAATTAAACAAGCGTACAAACAATTAGCAAGAAAGTACCACCCAGATGTTTCACCTCCGGGTCGGGTCGAAGAAAATACCCAA
AGGTTTATTCGGGTTCAAGAGGCTTATGAGACATTATCGGATCCTAAATCAAGAGATATGTATGACAAACATATGTCTAAAGGACTTCAT
TTTGCATTTTCTCCTCGTAGAAAGTGCCAAAATGATGAGTCAATGGAGAACACCGGTGAATGGAAGAATCGATGGCATTCTCAGCTATCG
GAGTTGAAAAGAAGAAACTCACACAAGGACTCTGGTAACAATATGTCATGGGGTGCACATATGCGTAGACAAAGGAGTGAAACATCGTTA
TAA\
Edits in Original Sequence 
(5')AAGAAAAAAATGTATCTAAGAACCCCAATAGATCGTGTCCTATTTTCCCCATCAAATCCCCAATTTTCAAGAACTCAAAAAGTGTC
TTTTAGAGTAAACTCAAAACTTAACAACAATGTGATAGAAATTAGTGAATCAAAAAGCTTTTATGAGCTTTTGGGTATTCAAGAAACTGT
TTCTTTATTAGAAATTAAACAAGCGTACAAACAATTAGCAAGAAAGTACCACCCAGATGTTTCACCTCCGGGTCGGGTCGAAGAAAATAC
CCAAAGGTTTATTCGGGTTCAAGAGGCTTATGAGACATTATCGGATCCTAAATCAAGAGATATGTATGACAAACATATGTCTAAAGGACT
TCATTTTGCATTTTCTCCTCGTAGAAAGTGCCAAAATGATGAGTCAATGGAGAACACCGGTGAATGGAAGAATCGATGGCATTCTCAGCT
ATCGGAGTTGAAAAGAAGAAACTCACACAAGGACTCTGGTAACAATATGTCATGGGGTGCACATATGCGTAGACAAAGGAGTGAAACATC
GTTATAA\(3')CGAATTATATAGTTTTTATATATTGCTTATATATAATTTGAAGTGTTTGGTTAAGCATTGATGTTATAAGTAGTGTAA
CAACTATATGTAAGTGCTGACCAAATATAGGTAACTGTTTGTACATAAGAGTTCTTTGAATCAAGTTGTTATTTTTAAAAAAAAAAAAAA
AAAACTCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan