ESTScan Details for Unigene SGN-U216926

Score 
451
Direction 
Forward
Predicted Peptide Sequence 
MDREGGSAGSCYYSVLGVRNDASCSDIRSAYRKLALKWHPDRWAKNPALAGEAKLRFQKIQEAYSVLSDQDKRSMYDAGFLDMFEEDEGM
GDFLHDLINRMDQNVGAAEESLEDLQKTFVDMFGRDLAKMMGDETPTAKKRARDSGCSTMAASKRNNVNFNGTC
Predicted Coding Sequence 
ATGGATCGAGAAGGAGGATCAGCCGGATCTTGTTATTATTCAGTTCTAGGGGTACGCAACGACGCCTCCTGCTCCGACATTCGCTCAGCT
TATCGGAAACTAGCTCTGAAATGGCACCCGGATAGGTGGGCGAAGAATCCAGCGCTGGCCGGTGAAGCGAAACTCCGATTTCAGAAAATC
CAAGAGGCTTATTCAGTTCTCTCCGATCAAGACAAGAGGTCAATGTACGACGCCGGTTTCCTCGATATGTTTGAGGAAGATGAAGGAATG
GGTGATTTCCTGCATGATTTGATAAACCGAATGGATCAAAATGTTGGAGCAGCGGAGGAGAGTCTAGAGGATTTGCAGAAGACGTTTGTG
GATATGTTTGGTAGAGATTTAGCAAAGATGATGGGTGATGAAACTCCAACTGCAAAGAAGAGGGCACGTGATTCTGGTTGCAGCACAATG
GCTGCATCAAAACGCAACAATGTCAACTTCAATGGCACCTGTTAG\
Edits in Original Sequence 
TTTTCATCGTTTTTTCCTATAACACAAACCTTACAAAAGCATCTTCTTTACGTTACACATTTGCCTTTCTGCCTCCCATCATTTTTTTTC
CTCTCCAAATTATCAAAATTATTGCCCCAGTTTCTCTCTGGTTTGGAACTGCATTTATCTATGGTTTAATTGAATTAATAAATTTTTTTT
CTCTACTCTGTACCCGTCAATTTAGGTACAGTTTCAGTTTTCGCAACAATTTTTTGGGATTTTGGCTCTGGCTTAGAGACATAACAAAAA
GCGGTT
(5')ATGGATCGAGAAGGAGGATCAGCCGGATCTTGTTATTATTCAGTTCTAGGGGTACGCAACGACGCCTCCTGCTCCGACAT
TCGCTCAGCTTATCGGAAACTAGCTCTGAAATGGCACCCGGATAGGTGGGCGAAGAATCCAGCGCTGGCCGGTGAAGCGAAACTCCGATT
TCAGAAAATCCAAGAGGCTTATTCAGTTCTCTCCGATCAAGACAAGAGGTCAATGTACGACGCCGGTTTCCTCGATATGTTTGAGGAAGA
TGAAGGAATGGGTGATTTCCTGCATGATTTGATAAACCGAATGGATCAAAATGTTGGAGCAGCGGAGGAGAGTCTAGAGGATTTGCAGAA
GACGTTTGTGGATATGTTTGGTAGAGATTTAGCAAAGATGATGGGTGATGAAACTCCAACTGCAAAGAAGAGGGCACGTGATTCTGGTTG
CAGCACAATGGCTGCATCAAAACGCAACAATGTCAACTTCAATGGCACCTGTTAG\(3')TTTATTTAGTTTTAAGCAAAAAATACAGAA
GAGGTCCCTCCACCTCCTCTCTTTTGGTGTCTGAATTTTTGTGGGGCTGGAGAGGAATTAACATGTTTATTTTCGGTGGTAGATAGGCAG
AACAGAACCTTTTTCTTTTTTTAGACTTTTGATATCTAAGGAACAAGTTGTTTAAAATGTGGGTGCTGTTTAGTTGCGTAATAAAACGTC
TCTTTAATTTATTATATTAGTACATCTTTTTTGTGGCTCTTTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan