ESTScan Details for Unigene SGN-U216927

Score 
385
Direction 
Reverse
Predicted Peptide Sequence 
MVKEESLEDLQKTFVDMFGRDLAKMMGDETPTAKKRARDSGCSTMAASKRNNVNFNGTC
Predicted Coding Sequence 
ATGGTGAAGGAGGAGAGTCTAGAGGATTTGCAGAAGACGTTTGTGGATATGTTTGGTAGAGATTTAGCAAAGATGATGGGTGATGAAACT
CCAACTGCAAAGAAGAGGGCACGTGATTCTGGTTGCAGCACAATGGCTGCATCAAAACGCAACAATGTCAACTTCAATGGCACCTGTTAG
\
Edits in Original Sequence 
TCACTCATCCCCATTTATTAAAAAAAATTCAACTATTACATTTTTGCGAGTTTTAGCTTTCAATTATCAACGTTTAGGTAATAATAGAAC
ACTAATACAATTTATCTGTATGCAGGGAATGGGTGATTTCCTGCATGATTTGATAAACCGAATGGATCAAAATGTTGGAGCAGCGGTAAG
ATATTTTGATGAGTTCTACTCCTACATGATTTTTGTGCGTGTATGATTCATTTTTGAAATGATGTGCTTATTTATTGTGTAATTAAAA
(5')
ATGGTGAAGGAGGAGAGTCTAGAGGATTTGCAGAAGACGTTTGTGGATATGTTTGGTAGAGATTTAGCAAAGATGATGGGTGATGAAA
CTCCAACTGCAAAGAAGAGGGCACGTGATTCTGGTTGCAGCACAATGGCTGCATCAAAACGCAACAATGTCAACTTCAATGGCACCTGTT
AG\(3')TTTATTTAGTTTTAAGCAAAAAATACAGAAGAGGTCCCTCCACCTCCTCTCTTTTGGTGTCTGAATTTTTGTGGGGCTGGAGA
GGAATTAACATGTTTAAATTCGGTGGTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan