ESTScan Details for Unigene SGN-U216967

Score 
950
Direction 
Forward
Predicted Peptide Sequence 
AVNVYAFSDKYTDIATIGTLAKYTGGQVYYYPSFQASVHKDRLRHELTRDLTRETAWESVMRIRCGKGVRFTTYHGNFMLRSTDLIALPA
VDCDKAYAMQLSLEETLLTSQTVFFQIALLYTSSSGERRIRVHTAAAPVVSDLGEMYRLADTGAIISLFTRLAIEKTLTSKLEEARNSIQ
LRIVKALREYRNLHAVQHRVAGRMIYPESLKYLPLYGLALCKTTALRGGYADAQLDERCAAGYTMMALPVKRLLKLLYPKLIRIDEYLLK
KPSSREESKDILKGVPLTTESLDPQGLYLFDDGFRFVIWFGRMLSPNMIQSLLGENFAADFSKVSLQELDNEMSRELMGLLKRQRESDRS
YYQLCHLVRQGEQPREGFFLLANLIEDPVGGSIGYQVGFCKYTDKSSKMHKGFLYVQSFVVFYCVAVPEEVGTLLPLATMDGSSNEQKLP
WKKSAVSVXLTPLIAELTXIFLVTLVEELIFLLMLGSFHTPGPAMHYDVGAGRLXSSLNASITPAAPFAWGEHEKNAN
Predicted Coding Sequence 
XTAGCAGTCAATGTATATGCTTTCAGTGACAAATATACTGACATAGCTACTATAGGTACGCTGGCAAAGTACACAGGTGGTCAGGTGTAC
TACTATCCAAGTTTTCAAGCGTCCGTTCACAAAGATAGATTGCGTCACGAGTTAACCCGAGATCTTACAAGGGAGACTGCTTGGGAGTCT
GTCATGCGCATAAGATGTGGAAAAGGTGTTCGTTTTACAACATATCATGGGAACTTCATGCTGAGATCCACTGATCTGATAGCACTTCCT
GCTGTTGACTGTGATAAAGCATATGCAATGCAGTTATCCCTTGAAGAAACACTACTCACTTCCCAGACAGTATTTTTCCAAATTGCTCTA
CTATACACATCATCTTCTGGAGAAAGGCGCATTAGAGTACACACAGCAGCAGCACCGGTTGTTTCAGATTTAGGAGAAATGTATCGCCTA
GCTGATACTGGTGCTATCATTTCTCTTTTTACCAGGCTTGCCATTGAGAAAACTCTGACCTCTAAATTAGAGGAGGCTCGAAATTCTATT
CAACTCAGGATTGTGAAAGCTCTTAGAGAATATCGAAATCTCCATGCTGTTCAGCACCGTGTGGCTGGAAGGATGATTTATCCAGAATCT
TTAAAGTACTTGCCATTATATGGATTAGCTTTATGCAAAACAACTGCCCTTCGCGGTGGATATGCTGATGCTCAGCTTGACGAACGATGT
GCTGCTGGATATACCATGATGGCTTTGCCCGTTAAAAGATTGTTGAAGCTTCTATATCCTAAGTTGATCCGTATAGATGAATATCTTCTA
AAAAAACCATCTTCGCGAGAGGAGTCTAAAGACATCTTGAAAGGGGTTCCACTTACAACAGAGAGCTTAGATCCCCAGGGTCTCTATCTC
TTTGATGATGGTTTCCGGTTTGTCATCTGGTTCGGTAGAATGCTTTCTCCTAATATGATCCAGAGTTTGCTCGGAGAAAACTTTGCTGCT
GACTTCTCTAAGGTTTCACTTCAAGAGCTAGATAATGAAATGTCAAGAGAACTGATGGGTTTGCTTAAAAGACAGAGGGAGAGTGACAGA
TCATATTATCAGTTATGCCATCTTGTGAGGCAAGGTGAACAGCCTAGAGAAGGCTTCTTCTTGCTTGCAAATCTGATTGAGGATCCAGTT
GGTGGTTCTATTGGTTACCAGGTTGGATTCTGCAAGTACACCGACAAGTCCAGCAAAATGCATAAAGGGTTCCTGTATGTTCAATCATTT
GTGGTCTTCTACTGTGTGGCGGTTCCTGAAGAAGTTGGAACXTTGTTGCCACTTGCAACTATGGATGGTTCATCCAATGAGCAAAAGCTT
CCATGGAAGAAATCTGCTGTTAGTGTTAAXTTGACACCATTGATTGCTGAGCTTACCTGXATTTTCCTTGTAACATTAGTTGAAGAACTA
ATATTTCTCCTCATGTTGGGATCATTTCATACACCTGGACCAGCCATGCATTATGATGTGGGAGCAGGAAGATTGTGATCGTCCTTAAAT
GCTAGCATTACCCCXGCTGCCCCATTTGCTTGGGGTGAACATGAAAAAAATGCTAATTGA\
Edits in Original Sequence 
(5')XTAGCAGTCAATGTATATGCTTTCAGTGACAAATATACTGACATAGCTACTATAGGTACGCTGGCAAAGTACACAGGTGGTCAGGT
GTACTACTATCCAAGTTTTCAAGCGTCCGTTCACAAAGATAGATTGCGTCACGAGTTAACCCGAGATCTTACAAGGGAGACTGCTTGGGA
GTCTGTCATGCGCATAAGATGTGGAAAAGGTGTTCGTTTTACAACATATCATGGGAACTTCATGCTGAGATCCACTGATCTGATAGCACT
TCCTGCTGTTGACTGTGATAAAGCATATGCAATGCAGTTATCCCTTGAAGAAACACTACTCACTTCCCAGACAGTATTTTTCCAAATTGC
TCTACTATACACATCATCTTCTGGAGAAAGGCGCATTAGAGTACACACAGCAGCAGCACCGGTTGTTTCAGATTTAGGAGAAATGTATCG
CCTAGCTGATACTGGTGCTATCATTTCTCTTTTTACCAGGCTTGCCATTGAGAAAACTCTGACCTCTAAATTAGAGGAGGCTCGAAATTC
TATTCAACTCAGGATTGTGAAAGCTCTTAGAGAATATCGAAATCTCCATGCTGTTCAGCACCGTGTGGCTGGAAGGATGATTTATCCAGA
ATCTTTAAAGTACTTGCCATTATATGGATTAGCTTTATGCAAAACAACTGCCCTTCGCGGTGGATATGCTGATGCTCAGCTTGACGAACG
ATGTGCTGCTGGATATACCATGATGGCTTTGCCCGTTAAAAGATTGTTGAAGCTTCTATATCCTAAGTTGATCCGTATAGATGAATATCT
TCTAAAAAAACCATCTTCGCGAGAGGAGTCTAAAGACATCTTGAAAGGGGTTCCACTTACAACAGAGAGCTTAGATCCCCAGGGTCTCTA
TCTCTTTGATGATGGTTTCCGGTTTGTCATCTGGTTCGGTAGAATGCTTTCTCCTAATATGATCCAGAGTTTGCTCGGAGAAAACTTTGC
TGCTGACTTCTCTAAGGTTTCACTTCAAGAGCTAGATAATGAAATGTCAAGAGAACTGATGGGTTTGCTTAAAAGACAGAGGGAGAGTGA
CAGATCATATTATCAGTTATGCCATCTTGTGAGGCAAGGTGAACAGCCTAGAGAAGGCTTCTTCTTGCTTGCAAATCTGATTGAGGATCC
AGTTGGTGGTTCTATTGGTTACCAGGaTTGGATTCTGCAAGTACACCGACAAGTCCAGCAAAATGCATAAAGGGTTCCTGTATGTTCAAT
CATTTGTGGTCTTCTACTGTGTGGCGGTTCCTGAAGAAGTTGGAACXTTGTTGCCACTTGCAACTATGGATGGTTCATCCAATGAGCAAA
AGCTTCCATGGAAGAAATCTGCTGTTAGTGTTAAXTTGACACCATTGATTGCTGAGCTTACCTGXATTTTCCTTGTAACATTAGTTGAAG
AACTAATATTTCTCCTCATGTTGGGATCATTTCATACACCTGGACCAGCCATGCATTATGATGTGGGAGCAGGAAGATTGTGATCGTCCT
TAAATGCTAGCATTACCCCXGCTGCCCCATTTGCTTGGGGTGAACATGAAAAAAATGCTAATTGA\(3')CTAGTATTTATTTTCACGTG
TTGGTCTGGTTAGAGTGAGATGAGACATTAAATAGAACAATGTTGCAGTTATTTATATTCTTGATGTTGTGGGGATAGGGTATGCGTTTG
AGTGGGATTTATTTAGACTTTTTGTAGAGATCTTGTACATGCATTTGCTTTGCATAACTGAATTTTTTTTGCTGCCCGTAATAAATTTTT
GTTGAGCTGAAAAAAAAAAAAAAAAAAAAAAAAGAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan