ESTScan Details for Unigene SGN-U216987

Score 
611
Direction 
Forward
Predicted Peptide Sequence 
NRGLVKFHRSKRSNSKTIVKTRHHVEELGGFLFKTPHIQIFISRLPLLNHGVASRSTSTAAGSGPESTEAAGTVKVGFSSTEWVRTGSPT
SSAVDLSSFAAASVLKGRDIVDMAKHYGRCYAELSKARLSMLVVATSGTGYILGSGSAIDYMGLCCTCAGTMMVAASASTLNQVFEVKND
AKMNRTKKRPLPSGRISIPHAVTWAASIGILGTGLLASKANMLAAGLGASNLVLYAFVYTPLKQIHPINTWVGAIVGAIPPLLGWAAASG
QVSLNGMLLPAALYFWQIPHFMALAYLCRKDYADGGFRMYSLADASGHRTASGTLQKLPISTAX
Predicted Coding Sequence 
AACAGAGGACTTGTGAAATTTCATAGGTCAAAAAGATCAAACTCTAAAACAATTGTCAAGACTCGGCACCATGTGGAGGAACTCGGTGGG
TTTCTCTTCAAAACTCCTCACATCCAAATCTTCATCAGTCGTCTTCCTTTGCTTAATCATGGCGTTGCCAGCAGATCCACTTCTACAGCC
GCCGGCTCCGGACCGGAGTCTACTGAAGCAGCCGGTACAGTAAAGGTGGGATTTTCATCGACGGAGTGGGTTCGAACCGGATCTCCGACT
TCTTCAGCTGTCGATCTTTCATCTTTTGCGGCTGCATCAGTTTTGAAAGGTAGGGATATTGTGGACATGGCTAAGCATTACGGGCGGTGT
TATGCGGAGCTTTCTAAAGCTCGCTTAAGCATGCTTGTAGTTGCAACCTCTGGCACTGGGTATATCCTTGGGAGTGGTAGTGCCATTGAC
TACATGGGACTTTGCTGCACATGTGCTGGCACAATGATGGTTGCGGCATCAGCTAGCACATTAAATCAGGTGTTTGAGGTGAAAAATGAT
GCTAAGATGAACAGAACCAAGAAAAGACCATTGCCGTCAGGACGAATCAGTATACCCCATGCAGTAACATGGGCAGCTTCTATTGGCATC
CTGGGCACTGGTTTACTGGCTAGCAAGGCTAATATGTTGGCAGCTGGCCTTGGTGCGTCGAATCTTGTGTTGTATGCATTTGTATACACA
CCACTAAAGCAGATACATCCAATTAATACATGGGTCGGCGCAATTGTTGGAGCTATTCCTCCCCTGCTTGGGTGGGCTGCAGCTTCTGGT
CAGGTGTCTCTCAATGGAATGCTCCTCCCAGCTGCTCTGTATTTTTGGCAAATACCTCATTTCATGGCCTTAGCCTACTTGTGTCGTAAA
GATTATGCTGACGGAGGGTTCAGAATGTACTCTCTTGCTGATGCTTCTGGTCATAGGACTGCCTCTGGAACXCTTCAGAAACTGCCTATA
TCTACTGCCAXX\
Edits in Original Sequence 
(5')AACAGAGGACTTGTGAAATTTCATAGGTCAAAAAGATCAAACTCTAAAACAATTGTCAAGACTCGGCACCATGTGGAGGAACTCGG
TGGGTTTCTCTTCAAAACTCCTCACATCCAAATCTTCATgCAGTCGTCTTCCTTTGCTTAATCATGGCGTTGCCAGCAGATCCACTTCTA
CAGCCGCCGGCTCCGGACCGGAGTCTACTGAAGCAGCCGGTACAGTAAAGGTGGGATTTTCATCGACGGAGTGGGTTCGAACCGGATCTC
CGACTTCTTCAGCTGTCGATCTTTCATCTTTTGCGGCTGCATCAGTTTTGAAAGGTAGGGATATTGTGGACATGGCTAAGCATTACGGGC
GGTGTTATGCGGAGCTTTCTAAAGCTCGCTTAAGCATGCTTGTAGTTGCAACCTCTGGCACTGGGTATATCCTTGGGAGTGGTAGTGCCA
TTGACTACATGGGACTTTGCTGCACATGTGCTGGCACAATGATGGTTGCGGCATCAGCTAGCACATTAAATCAGGTGTTTGAGGTGAAAA
ATGATGCTAAGATGAACAGAACCAAGAAAAGACCATTGCCGTCAGGACGAATCAGTATACCCCATGCAGTAACATGGGCAGCTTCTATTG
GCATCCTGGGCACTGGTTTACTGGCTAGCAAGGCTAATATGTTGGCAGCTGGCCTTGGTGCGTCGAATCTTGTGTTGTATGCATTTGTAT
ACACACCACTAAAGCAGATACATCCAATTAATACATGGGTCGGCGCAATTGTTGGAGCTATTCCTCCCCTGCTTGGGTGGGCTGCAGCTT
CTGGTCAGGTGTCTCTCAATGGAATGCTCCTCCCAGCTGCTCTGTATTTTTGGCAAATACCTCATTTCATGGCCTTAGCCTACTTGTGTC
GTAAAGATTATGCTGACGGAGGGTTCAGAATGTACTCTCTTGCTGATGCTTCTGGTCATAGGACTGCCTCTGGAACXCTTCAGAAACTGC
CTATATCTACTGCCAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan