ESTScan Details for Unigene SGN-U217001

Score 
588
Direction 
Forward
Predicted Peptide Sequence 
KPFSLSCKDFMSNNITRFKKIGRLXIEAAIMAHLLSTTCSLDVSSSKKLHFKSINQCSTPNPTCFNMGISFSPLKLSLQSKRSAKYVIRA
SAVSMSQEARTQNDSGSQQTTDGASTRKKVMVIGGDGYCGWATALHLSNKGYEVAIVDNLIRRLFDDQLGLDSLTPISSIHNRIRRWKSL
TGKDIQLFVGDICEFEFLAEAFKSFEPDAVVHFGEQRSAPYSMIDRSRAIYTQHNNVIGTLNVLFAIKEFREECHLVKLGTMGEYGTPNI
DIEEGYITITHNGRTDTLPYPKQASSFYHLSKVHDSHNIAFTCKAWGIRATDLNQGVVYGVRTDETAIHEDLVNRLDYDGVFGTALNRFC
VQAAVGHPLTVYG
Predicted Coding Sequence 
XXAAAACCTTTCTCACTCTCTTGTAAGGATTTTATGTCTAACAACATCACCAGGTTTAAGAAAATTGGTAGGCTCATXATCGAGGCGGCT
ATCATGGCACATTTACTTTCTACTACATGTTCTTTAGATGTCTCTTCCAGCAAAAAGCTGCATTTCAAGTCAATTAACCAATGCTCTACT
CCTAATCCAACATGTTTTAATATGGGAATTTCTTTCTCACCCTTGAAGCTAAGTTTGCAAAGCAAAAGGTCTGCAAAATATGTGATCAGA
GCTTCAGCTGTTTCCATGAGCCAAGAAGCCAGAACACAGAATGACTCTGGTTCTCAACAGACCACTGATGGAGCATCCACTAGGAAGAAG
GTCATGGTCATTGGTGGTGATGGCTATTGTGGCTGGGCTACTGCTCTCCACCTATCCAACAAGGGATATGAAGTTGCCATTGTTGACAAC
CTTATCCGTCGATTATTTGACGACCAGCTTGGTCTAGATTCTCTAACACCCATCTCATCTATTCATAACCGCATAAGGCGTTGGAAATCT
CTCACAGGAAAAGATATTCAACTGTTTGTTGGTGATATATGTGAGTTTGAGTTCTTGGCAGAAGCCTTCAAATCCTTTGAACCTGATGCT
GTAGTCCATTTTGGAGAGCAGAGGTCTGCCCCTTATTCTATGATTGATAGGTCAAGAGCTATTTATACCCAACATAATAATGTGATAGGG
ACACTTAATGTACTATTTGCCATAAAGGAGTTTAGGGAAGAGTGTCATTTGGTCAAACTCGGGACCATGGGGGAATATGGAACCCCTAAT
ATAGATATTGAAGAAGGTTATATAACTATTACTCATAACGGAAGAACAGATACTCTTCCTTATCCCAAACAAGCAAGCTCCTTCTATCAT
TTGAGTAAAGTCCATGATTCCCACAACATAGCCTTCACTTGCAAGGCGTGGGGAATCAGAGCTACCGACCTGAATCAGGGAGTTGTATAT
GGGGTGAGGACTGATGAAACTGCAATACATGAGGATCTGGTTAACAGACTTGATTATGATGGTGTATTTGGAACTGCACTAAATCGTTTC
TGTGTTCAGGCTGCTGTTGGACATCCACTAACGGTGTATGGT\
Edits in Original Sequence 
(5')XXAAAACCTTTCTCACTCTCTTGTAAGGATTTTATGTCTAACAAgCATCACCAGGTTTAAGAAAATTGGTAGGCTCATXATCGAGG
CGGCTATCATGGCACATTTACTTTCTACTACATGTTCTTTAGATGTCTCTTCCAGCAAAAAGCTGCATTTCAAGTCAATTAACCAATGCT
CTACTCCTAATCCAACATGTTTTAATATGGGAATTTCTTTCTCACCCTTGAAGCTAAGTTTGCAAAGCAAAAGGTCTGCAAAATATGTGA
TCAGAGCTTCAGCTGTTTCCATGAGCCAAGAAGCCAGAACACAGAATGACTCTGGTTCTCAACAGACCACTGATGGAGCATCCACTAGGA
AGAAGGTCATGGTCATTGGTGGTGATGGCTATTGTGGCTGGGCTACTGCTCTCCACCTATCCAACAAGGGATATGAAGTTGCCATTGTTG
ACAACCTTATCCGTCGATTATTTGACGACCAGCTTGGTCTAGATTCTCTAACACCCATCTCATCTATTCATAACCGCATAAGGCGTTGGA
AATCTCTCACAGGAAAAGATATTCAACTGTTTGTTGGTGATATATGTGAGTTTGAGTTCTTGGCAGAAGCCTTCAAATCCTTTGAACCTG
ATGCTGTAGTCCATTTTGGAGAGCAGAGGTCTGCCCCTTATTCTATGATTGATAGGTCAAGAGCTATTTATACCCAACATAATAATGTGA
TAGGGACACTTAATGTACTATTTGCCATAAAGGAGTTTAGGGAAGAGTGTCATTTGGTCAAACTCGGGACCATGGGGGAATATGGAACCC
CTAATATAGATATTGAAGAAGGTTATATAACTATTACTCATAACGGAAGAACAGATACTCTTCCTTATCCCAAACAAGCAAGCTCCTTCT
ATCATTTGAGTAAAGTCCATGATTCCCACAACATAGCCTTCACTTGCAAGGCGTGGGGAATCAGAGCTACCGACCTGAATCAGGGAGTTG
TATATGGGGTGAGGACTGATGAAACTGCAATACATGAGGATCTGGTTAACAGACTTGATTATGATGGTGTATTTGGAACTGCACTAAATC
GTTTCTGTGTTCAGGCTGCTGTTGGACATCCACTAACGGTGTATGGT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan