ESTScan Details for Unigene SGN-U217062

Score 
447
Direction 
Forward
Predicted Peptide Sequence 
EMKVAPKVILLFRDPTGFGTAIFEALQPNPKSNLQKRQESLDLSLQHYGIKDQKVSVEVVHFLNGANLEVSLLLLENYEPPTLACALNEV
LALLVGDGLSNMPTIVAPFVVAASKLKMENRTSVSIDNRSVYGLQVGASSDLTKALCTNLQSPPPSLQICNEQLACLLQLVRVLKMPTYV
IIGKKGQNLHRKTSEEEHEVIHEIGQHLASFSSLSFSGEKIAWDATKSSKETQEPWRAXIWLNLNAGHNQRLTWRRVIDXQYAPKVGVPA
DVWVSTIVCGXMNPERRQYFLEADEDANVKLLCSILNFLSCIPWHLLLNQ
Predicted Coding Sequence 
XAAGAAATGAAGGTAGCCCCAAAAGTAATACTACTCTTCAGAGATCCAACTGGCTTCGGCACCGCCATCTTCGAAGCTCTTCAACCAAAC
CCTAAATCCAACCTTCAAAAGCGACAAGAATCGCTCGATTTATCCTTACAACATTACGGAATTAAAGATCAAAAGGTTTCGGTTGAAGTC
GTTCATTTTCTCAATGGAGCAAATCTCGAGGTGTCTCTGTTACTACTGGAAAACTATGAGCCTCCAACACTTGCTTGTGCACTCAATGAA
GTTCTGGCTTTGTTAGTAGGAGATGGGTTGTCAAATATGCCCACAATTGTAGCCCCTTTTGTTGTGGCTGCATCTAAGCTTAAGATGGAA
AATAGAACTTCTGTTTCAATTGACAATAGATCAGTTTATGGGTTGCAAGTAGGTGCCTCTAGTGACCTTACTAAAGCTTTGTGCACAAAT
TTGCAAAGCCCTCCCCCATCGTTGCAGATTTGTAACGAACAGTTGGCCTGCCTACTTCAATTGGTTCGAGTCCTGAAGATGCCTACTTAT
GTTATAATTGGCAAAAAAGGTCAAAATTTGCATCGTAAGACTTCGGAAGAGGAACACGAGGTGATACATGAGATAGGACAGCATTTGGCT
AGCTTCTCATCTCTTAGTTTTTCAGGAGAAAAGATAGCCTGGGATGCAACAAAGTCTTCGAAAGAAACTCAAGAGCCTTGGCGTGCATTX
ATATGGTTGAATCTTAATGCTGGCCATAATCAGCGTCTAACATGGCGTCGTGTTATTGATXTTCAGTATGCTCCTAAGGTAGGAGTTCCA
GCAGATGTGTGGGTAAGCACAATTGTGTGTGGTGXTATGAACCCAGAGAGACGCCAATATTTCCTCGAGGCAGACGAAGACGCCAATGTA
AAGCTTCTTTGTTCCATTCTCAATTTTCTTTCTTGTATCCCATGGCATCTGTTGCTTAACCAGTAA\
Edits in Original Sequence 
(5')XAAGAAATGAAGGTAGCCCCAAAAGTAATACTACTCTTCAGAGATCCAACTGGCTTCGGCACCGCCATCTTCGAAGCTCTTCAACC
AAACCCTAAATCCAACCTTCAAAAGCGACAAGAATCGCTCGATTTATCCTTACAACATTACGGAATTAAAGATCAAAAGGTTTCGGTTGA
AGTCGTTCATTTTCTCAATGGAGCAAATCTCGAGGTGTCTCTGTTACTACTGGAAAACTATGAGCCTCCAACACTTGCTTGTGCACTCAA
TGAAGTTCTGGCTTTGTTAGTAGGAGATGGGTTGTCAAATATGCCCACAATTGTAGCCCCTTTTGTTGTGGCTGCATCTAAGCTTAAGAT
GGAAAATAGAACTTCTGTTTCAATTGACAATAGATCAGTTTATGGGTTGCAAGTAGGTGCCTCTAGTGACCTTACTAAAGCTTTGTGCAC
AAATTTGCAAAGCCCTCCCCCATCGTTGCAGATTTGTAACGAACAGTTGGCCTGCCTACTTCAATTGGTTCGAGTCCTGAAGATGCCTAC
TTATGTTATAATTGGCAAAAAAGGTCAAAATTTGCATCGTAAGACTTCGGAAGAGGAACACGAGGTGATACATGAGATAGGACAGCATTT
GGCTAGCTTCTCATCTCTTAGTTTTTCAGGAGAAAAGATAGCCTGGGATGCAACAAAGTCTTCGAAAGAAACTCAAGAGCCTTGGCGTGC
ATTXATATGGTTGAATCTTAATGCTGGCCATAATCAGCGTCTAACATGGCGTCGTGTTATTGATXTTCAGTATGCTCCTAAGGTAGGAGT
TCCAGCAGATGTGTGGGTAAGCACAATTGTGTGTGGTGXTATGAACCCAGAGAGACGCCAATATTTCCTCGAGGCAGACGAAGACGCCAA
TGTAAAGCTTCTTTGTTCCATTCTCAATTTTCTTTCTTGTATCCCATGGCATCTGTTGCTTAACCAGTAA\(3')AATCCTCGATGTTTT
TTTAATATTAGTCAAATATAAACCATACAACTCTTAATTATTCTTATTAACCTTTATATTATATAAATAGAGACCATATATATACGATCA
AAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan